SecReT6
Protein ID: 319796149
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5523
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6004714..6007635 [-]
Productrhs element vgr protein
NoteTssI
UniProt IDE6VAD4
KEGG IDvpe:Varpa_5523
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 56..375
Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 433..475
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 253..288
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 712..865
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 554..664
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 738..763
Phage_base_V [PF04717], Evalue: 3.00E-19, Aligned region: 435..536
Protein Sequence: 973 a.a.     [Download]
>gi|319796149|ref|YP_004157789.1| rhs element vgr protein [Variovorax paradoxus EPS]
MSSDTSNSFMPTYGATPWTSEGLNVARLSEQARLIKLQLPQAAPQNAVVVERFTATEGINELFAFTIDTL
ATSSEFDPFALIGEELSLRLLLANGSFRTWHGYLTAVDALGGDGGLARYRLHLQPWLAALGLRRDSFVYA
AKSVQDIVSEVFADHTTATFTFEVAQELPVRPTCVQYRESDLAFVMRLLTEEGLSFRFEHEQTKDGESGG
ANNNGNNNTTPSHHRLVIFDREAKSPDCALPEIRFHRVDATEQQDAITAWSSKRQLVSNAVTLNAWDASV
LQAPTGSTQSALAMGDVPVLEHYDGAGSQRYANNAAAARRAENQLVAFESRIKRYSAGGSVRQLGAGERF
TLTQHDRYEGQKFVTLRVRHEAANNLGAQAAQVLEAGELEKGSYRNSFEAQPAEAQIAPIWRPKPTAPEA
MVALVVGADDDEVPTAVHTQRDHRVQVRFHWQAQRAAAQQQSGQSGQGSLVAAGRHASNRQSVWLRVAAP
VAGPNWGAHHLPRVGSEVLVSFIEGDIDRPVVSQQLYNGQDLPPWSAGTDSSANHAGVLSGWHSRALDGS
GYNQWIADDAPGQVRTRLASSHATSQLNLGHLNAQSPDESNRGAWRGSGAELRSDAWVVTRAGEGLLIST
LAQERAAGSVQDTASVRGQLAGALREAQNLSDAAGGAKALALNATALLQPLIDDIDPQKNGHYPGSVNGQ
DAKEPKGGEGADSRQGQDPVPAFARPLMVLDANMSLNMATPASATVYAGEAIHWTAQEQAHMAAGKTVSF
AAGKSVGLYSHEGGIQVIAQEGPVSVQAHTDELEWLAKEGFTVTSSNDEIHVLAKQKITLKGGQTSIELD
GANITLKMPGLLDVKGASKSFVGPKGSPAELPLLPTGAINEAQHFIELNHHYDDLEPVKGAAYKLIFDNG
AVIRGKVDDNGFARHDGVPPGSAKVVWGEDERKWDGESKRPNDRFGAATDADAAIALVKGLMS
 
Nucleotide Sequence: 2922 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6007635-6004714 Variovorax paradoxus EPS chromosome, complete genome
ATGTCATCAGACACATCAAACAGCTTCATGCCGACCTATGGCGCAACGCCATGGACGTCCGAAGGCCTGA
ACGTTGCGCGCCTCTCCGAACAGGCGCGGCTCATCAAGCTGCAATTGCCCCAAGCGGCACCGCAGAACGC
CGTCGTCGTCGAGCGCTTCACCGCCACCGAAGGCATCAACGAACTCTTCGCCTTCACCATCGACACCCTC
GCCACGTCGAGCGAGTTCGATCCCTTCGCGCTGATCGGCGAGGAGCTGAGCCTGCGCCTGCTGCTCGCCA
ACGGCAGCTTCCGCACCTGGCACGGCTACCTCACGGCGGTCGACGCGCTGGGCGGCGATGGCGGCCTCGC
GCGCTACCGGCTGCACCTGCAGCCCTGGCTCGCCGCGCTCGGCCTGCGTCGCGACAGCTTCGTGTACGCC
GCCAAGAGCGTGCAGGACATCGTGAGCGAGGTGTTCGCCGATCACACCACCGCCACCTTCACCTTCGAAG
TCGCCCAAGAGTTGCCCGTGCGGCCGACCTGCGTGCAGTACCGCGAGTCGGACCTCGCCTTCGTGATGCG
TCTGCTCACGGAGGAGGGTTTGAGCTTTCGCTTCGAGCACGAGCAGACGAAAGATGGCGAGAGCGGCGGC
GCCAATAACAACGGCAACAACAACACGACGCCATCGCACCATCGCCTGGTGATCTTTGATCGCGAAGCGA
AGTCGCCCGATTGCGCACTGCCCGAGATCCGCTTCCACCGCGTCGACGCCACCGAGCAGCAGGACGCGAT
CACCGCATGGAGCAGCAAGCGCCAGCTCGTCAGCAACGCCGTGACGCTGAACGCGTGGGATGCCAGCGTG
CTGCAGGCGCCCACCGGCTCGACGCAGAGCGCGCTCGCCATGGGCGACGTGCCTGTGCTGGAGCACTACG
ACGGCGCGGGCTCCCAGCGCTACGCCAACAACGCCGCCGCCGCGCGGCGCGCCGAGAACCAGCTGGTGGC
GTTCGAGTCGCGCATCAAGCGCTACAGCGCCGGGGGCAGCGTGCGGCAGCTGGGCGCCGGCGAGCGCTTC
ACGCTCACGCAGCACGACCGCTACGAGGGCCAGAAATTCGTCACGCTGCGCGTGCGCCACGAAGCCGCCA
ACAACCTCGGCGCGCAGGCCGCGCAGGTGCTCGAGGCCGGCGAGCTCGAGAAGGGCAGCTATCGCAACAG
CTTCGAGGCGCAGCCAGCCGAAGCGCAGATCGCGCCGATCTGGCGGCCCAAGCCCACGGCGCCCGAGGCG
ATGGTCGCACTCGTGGTCGGCGCTGATGACGACGAGGTGCCGACGGCGGTTCACACGCAGCGCGATCACC
GCGTGCAGGTGCGCTTTCATTGGCAGGCGCAGCGGGCGGCAGCGCAACAGCAGTCGGGGCAGAGCGGGCA
AGGCAGTCTTGTCGCGGCGGGCCGGCATGCGAGCAATCGCCAGTCGGTATGGCTGCGCGTGGCCGCGCCG
GTGGCCGGGCCGAACTGGGGCGCGCACCATCTGCCGCGCGTCGGCTCGGAGGTGCTGGTGTCGTTCATCG
AAGGCGACATCGACCGGCCAGTGGTGAGCCAGCAGCTCTACAACGGACAGGATCTGCCGCCATGGTCCGC
AGGCACCGATTCGTCGGCCAACCACGCGGGCGTGCTCTCGGGCTGGCACAGCCGTGCGCTCGACGGCAGC
GGCTACAACCAATGGATCGCGGACGACGCGCCCGGGCAGGTGCGCACGCGCCTCGCCAGTTCGCATGCGA
CGAGCCAGCTGAACCTGGGGCATCTCAACGCGCAATCGCCCGACGAGAGCAATCGCGGTGCGTGGCGTGG
CAGCGGTGCCGAACTGCGCTCGGATGCGTGGGTCGTCACGCGCGCTGGCGAAGGGCTCTTGATTTCGACG
CTGGCGCAGGAGCGGGCCGCTGGCAGCGTGCAGGACACTGCGAGCGTGCGCGGTCAGTTGGCCGGTGCGT
TGCGCGAGGCGCAGAACCTGTCGGATGCCGCCGGTGGCGCCAAGGCACTGGCATTGAATGCGACGGCATT
GCTGCAGCCGCTCATCGACGACATCGATCCGCAGAAGAACGGGCACTACCCCGGCAGCGTCAATGGTCAG
GACGCGAAGGAGCCAAAGGGCGGCGAGGGGGCAGATTCACGTCAAGGTCAGGACCCGGTGCCAGCCTTCG
CTCGGCCACTCATGGTGCTGGACGCGAACATGAGCCTGAACATGGCCACGCCCGCGAGCGCGACGGTGTA
TGCGGGCGAGGCGATCCACTGGACCGCGCAGGAGCAGGCGCACATGGCGGCGGGCAAGACGGTGAGTTTT
GCGGCGGGCAAGTCGGTGGGGCTCTACAGCCACGAAGGCGGCATCCAGGTCATCGCGCAGGAGGGGCCGG
TGAGCGTGCAGGCGCATACCGATGAACTCGAATGGCTCGCGAAGGAGGGCTTCACGGTCACGAGCAGCAA
CGACGAGATCCACGTGCTGGCCAAGCAGAAGATCACGCTCAAGGGCGGGCAGACGAGCATCGAGCTGGAT
GGGGCGAACATCACGTTGAAGATGCCGGGGCTCTTGGATGTGAAGGGGGCGAGCAAGAGTTTTGTGGGGC
CGAAGGGGAGCCCGGCGGAGTTGCCACTCTTGCCTACCGGGGCAATCAACGAAGCCCAGCATTTCATCGA
GTTGAATCACCACTATGACGATCTGGAGCCCGTCAAAGGTGCGGCCTACAAGCTGATCTTCGACAACGGC
GCGGTTATCCGCGGAAAGGTCGATGACAACGGATTCGCGCGCCATGACGGCGTGCCGCCGGGATCGGCGA
AAGTCGTCTGGGGCGAGGACGAGCGCAAGTGGGACGGCGAATCGAAGCGACCGAATGACCGCTTCGGTGC
GGCCACGGATGCCGATGCGGCCATTGCACTGGTGAAAGGGTTGATGTCGTGA