SecReT6
Protein ID: 319796149
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5523
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6004714..6007635 [-]
Productrhs element vgr protein
NoteTssI
UniProt IDE6VAD4
KEGG IDvpe:Varpa_5523
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 56..375
Phage_GPD [PF05954], Evalue: 3.30E-64, Aligned region: 433..475
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 253..288
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 712..865
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 554..664
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 738..763
Phage_base_V [PF04717], Evalue: 3.00E-19, Aligned region: 435..536
Protein Sequence: 973 a.a.     [Download]
>gi|319796149|ref|YP_004157789.1| rhs element vgr protein [Variovorax paradoxus EPS]
MSSDTSNSFMPTYGATPWTSEGLNVARLSEQARLIKLQLPQAAPQNAVVVERFTATEGINELFAFTIDTL
ATSSEFDPFALIGEELSLRLLLANGSFRTWHGYLTAVDALGGDGGLARYRLHLQPWLAALGLRRDSFVYA
AKSVQDIVSEVFADHTTATFTFEVAQELPVRPTCVQYRESDLAFVMRLLTEEGLSFRFEHEQTKDGESGG
ANNNGNNNTTPSHHRLVIFDREAKSPDCALPEIRFHRVDATEQQDAITAWSSKRQLVSNAVTLNAWDASV
LQAPTGSTQSALAMGDVPVLEHYDGAGSQRYANNAAAARRAENQLVAFESRIKRYSAGGSVRQLGAGERF
TLTQHDRYEGQKFVTLRVRHEAANNLGAQAAQVLEAGELEKGSYRNSFEAQPAEAQIAPIWRPKPTAPEA
MVALVVGADDDEVPTAVHTQRDHRVQVRFHWQAQRAAAQQQSGQSGQGSLVAAGRHASNRQSVWLRVAAP
VAGPNWGAHHLPRVGSEVLVSFIEGDIDRPVVSQQLYNGQDLPPWSAGTDSSANHAGVLSGWHSRALDGS
GYNQWIADDAPGQVRTRLASSHATSQLNLGHLNAQSPDESNRGAWRGSGAELRSDAWVVTRAGEGLLIST
LAQERAAGSVQDTASVRGQLAGALREAQNLSDAAGGAKALALNATALLQPLIDDIDPQKNGHYPGSVNGQ
DAKEPKGGEGADSRQGQDPVPAFARPLMVLDANMSLNMATPASATVYAGEAIHWTAQEQAHMAAGKTVSF
AAGKSVGLYSHEGGIQVIAQEGPVSVQAHTDELEWLAKEGFTVTSSNDEIHVLAKQKITLKGGQTSIELD
GANITLKMPGLLDVKGASKSFVGPKGSPAELPLLPTGAINEAQHFIELNHHYDDLEPVKGAAYKLIFDNG
AVIRGKVDDNGFARHDGVPPGSAKVVWGEDERKWDGESKRPNDRFGAATDADAAIALVKGLMS
 
Nucleotide Sequence: 2922 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6007635-6004714 Variovorax paradoxus EPS chromosome, complete genome
ATGTCATCAGACACATCAAACAGCTTCATGCCGACCTATGGCGCAACGCCATGGACGTCCGAAGGCCTGA
ACGTTGCGCGCCTCTCCGAACAGGCGCGGCTCATCAAGCTGCAATTGCCCCAAGCGGCACCGCAGAACGC
CGTCGTCGTCGAGCGCTTCACCGCCACCGAAGGCATCAACGAACTCTTCGCCTTCACCATCGACACCCTC
GCCACGTCGAGCGAGTTCGATCCCTTCGCGCTGATCGGCGAGGAGCTGAGCCTGCGCCTGCTGCTCGCCA
ACGGCAGCTTCCGCACCTGGCACGGCTACCTCACGGCGGTCGACGCGCTGGGCGGCGATGGCGGCCTCGC
GCGCTACCGGCTGCACCTGCAGCCCTGGCTCGCCGCGCTCGGCCTGCGTCGCGACAGCTTCGTGTACGCC
GCCAAGAGCGTGCAGGACATCGTGAGCGAGGTGTTCGCCGATCACACCACCGCCACCTTCACCTTCGAAG
TCGCCCAAGAGTTGCCCGTGCGGCCGACCTGCGTGCAGTACCGCGAGTCGGACCTCGCCTTCGTGATGCG
TCTGCTCACGGAGGAGGGTTTGAGCTTTCGCTTCGAGCACGAGCAGACGAAAGATGGCGAGAGCGGCGGC
GCCAATAACAACGGCAACAACAACACGACGCCATCGCACCATCGCCTGGTGATCTTTGATCGCGAAGCGA
AGTCGCCCGATTGCGCACTGCCCGAGATCCGCTTCCACCGCGTCGACGCCACCGAGCAGCAGGACGCGAT
CACCGCATGGAGCAGCAAGCGCCAGCTCGTCAGCAACGCCGTGACGCTGAACGCGTGGGATGCCAGCGTG
CTGCAGGCGCCCACCGGCTCGACGCAGAGCGCGCTCGCCATGGGCGACGTGCCTGTGCTGGAGCACTACG
ACGGCGCGGGCTCCCAGCGCTACGCCAACAACGCCGCCGCCGCGCGGCGCGCCGAGAACCAGCTGGTGGC
GTTCGAGTCGCGCATCAAGCGCTACAGCGCCGGGGGCAGCGTGCGGCAGCTGGGCGCCGGCGAGCGCTTC
ACGCTCACGCAGCACGACCGCTACGAGGGCCAGAAATTCGTCACGCTGCGCGTGCGCCACGAAGCCGCCA
ACAACCTCGGCGCGCAGGCCGCGCAGGTGCTCGAGGCCGGCGAGCTCGAGAAGGGCAGCTATCGCAACAG
CTTCGAGGCGCAGCCAGCCGAAGCGCAGATCGCGCCGATCTGGCGGCCCAAGCCCACGGCGCCCGAGGCG
ATGGTCGCACTCGTGGTCGGCGCTGATGACGACGAGGTGCCGACGGCGGTTCACACGCAGCGCGATCACC
GCGTGCAGGTGCGCTTTCATTGGCAGGCGCAGCGGGCGGCAGCGCAACAGCAGTCGGGGCAGAGCGGGCA
AGGCAGTCTTGTCGCGGCGGGCCGGCATGCGAGCAATCGCCAGTCGGTATGGCTGCGCGTGGCCGCGCCG
GTGGCCGGGCCGAACTGGGGCGCGCACCATCTGCCGCGCGTCGGCTCGGAGGTGCTGGTGTCGTTCATCG
AAGGCGACATCGACCGGCCAGTGGTGAGCCAGCAGCTCTACAACGGACAGGATCTGCCGCCATGGTCCGC
AGGCACCGATTCGTCGGCCAACCACGCGGGCGTGCTCTCGGGCTGGCACAGCCGTGCGCTCGACGGCAGC
GGCTACAACCAATGGATCGCGGACGACGCGCCCGGGCAGGTGCGCACGCGCCTCGCCAGTTCGCATGCGA
CGAGCCAGCTGAACCTGGGGCATCTCAACGCGCAATCGCCCGACGAGAGCAATCGCGGTGCGTGGCGTGG
CAGCGGTGCCGAACTGCGCTCGGATGCGTGGGTCGTCACGCGCGCTGGCGAAGGGCTCTTGATTTCGACG
CTGGCGCAGGAGCGGGCCGCTGGCAGCGTGCAGGACACTGCGAGCGTGCGCGGTCAGTTGGCCGGTGCGT
TGCGCGAGGCGCAGAACCTGTCGGATGCCGCCGGTGGCGCCAAGGCACTGGCATTGAATGCGACGGCATT
GCTGCAGCCGCTCATCGACGACATCGATCCGCAGAAGAACGGGCACTACCCCGGCAGCGTCAATGGTCAG
GACGCGAAGGAGCCAAAGGGCGGCGAGGGGGCAGATTCACGTCAAGGTCAGGACCCGGTGCCAGCCTTCG
CTCGGCCACTCATGGTGCTGGACGCGAACATGAGCCTGAACATGGCCACGCCCGCGAGCGCGACGGTGTA
TGCGGGCGAGGCGATCCACTGGACCGCGCAGGAGCAGGCGCACATGGCGGCGGGCAAGACGGTGAGTTTT
GCGGCGGGCAAGTCGGTGGGGCTCTACAGCCACGAAGGCGGCATCCAGGTCATCGCGCAGGAGGGGCCGG
TGAGCGTGCAGGCGCATACCGATGAACTCGAATGGCTCGCGAAGGAGGGCTTCACGGTCACGAGCAGCAA
CGACGAGATCCACGTGCTGGCCAAGCAGAAGATCACGCTCAAGGGCGGGCAGACGAGCATCGAGCTGGAT
GGGGCGAACATCACGTTGAAGATGCCGGGGCTCTTGGATGTGAAGGGGGCGAGCAAGAGTTTTGTGGGGC
CGAAGGGGAGCCCGGCGGAGTTGCCACTCTTGCCTACCGGGGCAATCAACGAAGCCCAGCATTTCATCGA
GTTGAATCACCACTATGACGATCTGGAGCCCGTCAAAGGTGCGGCCTACAAGCTGATCTTCGACAACGGC
GCGGTTATCCGCGGAAAGGTCGATGACAACGGATTCGCGCGCCATGACGGCGTGCCGCCGGGATCGGCGA
AAGTCGTCTGGGGCGAGGACGAGCGCAAGTGGGACGGCGAATCGAAGCGACCGAATGACCGCTTCGGTGC
GGCCACGGATGCCGATGCGGCCATTGCACTGGTGAAAGGGTTGATGTCGTGA

Protein ID: 319796153
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5527
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6012977..6015805 [-]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6VAD8
KEGG IDvpe:Varpa_5527
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-73, Aligned region: 44..362
Phage_GPD [PF05954], Evalue: 7.60E-73, Aligned region: 396..533
Phage_GPD [PF05954], Evalue: 7.60E-73, Aligned region: 611..708
DUF2345 [PF10106], Evalue: 2.60E-42, Aligned region: 646..670
DUF2345 [PF10106], Evalue: 2.60E-42, Aligned region: 749..912
T6SS_Vgr [PF13296], Evalue: 1.50E-31, Aligned region: 211..245
T6SS_Vgr [PF13296], Evalue: 1.50E-31, Aligned region: 592..698
T6SS_Vgr [PF13296], Evalue: 1.50E-31, Aligned region: 818..862
Phage_base_V [PF04717], Evalue: 2.40E-18, Aligned region: 436..540
Sarcoglycan_1 [PF04790], Evalue: 0.0005, Aligned region: 763..848
Sarcoglycan_1 [PF04790], Evalue: 0.0005, Aligned region: 842..895
Protein Sequence: 942 a.a.     [Download]
>gi|319796153|ref|YP_004157793.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MTTFSTASLGGLLRARTTQQDRLLVLHTPLGANKLLAERFDGVESLDDGGFRFELTALSDDAHIELKTLM
GQGVRLDLQTAQSRTELRPFHGYVTEAECVASNGGMARYRIVIEPWLAFLRLRQDSCLFQHQSVFDIVDA
VFTRYQSQGKLAVQWRWEIAQRDIYPVRGITTQYHESDFDFVARLLAEEGLCYWFEHATGKDGDLGSHTL
VIADHNGAFRANTQATIRFHRADASEREDTIQQWRGSRQLQTNSLAQQSWDYKSVSARPVQQQSRGAGHR
TLQWSDDPGAYGWETSAQGERLLSNALQALELRNKRFEGQSAVRSLAPATTFTLSGHEQHDKDGEEDRRF
AVLAVRHIARNNFDEALKAGVGDRLGLPDIAAVFDASEDSGNAAAKPDTVTHYRNDFTTVRAAIPYRPLS
MDGHGQRIHPKPSVHGSQSAIVIGVGENAPVHTDRDHRVKVQFHWQRGSGSSARQPRPDGQDNAPAADRL
GAWVRVAASAAGDNWGQVTLPRVGQEVLVEFHHGDIDRPVVVAALYNGAGQIDAQHNEKSAGAAQSTGNA
PAWFAGEGKEAKEHAHNAVFSGIKTQELSASQSGDGGYNQLVFDDTPGQGSTSLATTQAMSRLHLGHHKQ
QDDNARGKARGHGAELATTAQGAIRAGSGLLVSAHAQQNAKGAFMASREAQQQTKQAEELATSLAKSAQT
QKAQLKGEEAPDKLPAIEALKHVAEVLGATQEGASASGVNGSGGDIKATEGGQGSVTAYSEPHLQFSAPM
GIGFVTPKEAIAVSGKNTAIVANQDIDLPAQGQIAVSVAKGVSLYTVGAKAGEGGEPNQERGIALHAASG
SVTLQSQKGATKIAADKKVTIASTTKNVDVEAPKHVLLTSAGAYIKLEGSSIKIHAPGKVTFRGMHNFVG
PQGDSSSNALSGSDQQPCPKQDDAAASGAVAF
 
Nucleotide Sequence: 2829 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6015805-6012977 Variovorax paradoxus EPS chromosome, complete genome
ATGACGACCTTCTCAACGGCTTCGCTTGGTGGCTTGCTGCGTGCACGCACGACGCAGCAGGATCGCCTGC
TGGTGCTGCACACGCCGCTGGGTGCCAACAAGCTGCTGGCCGAGCGCTTTGATGGCGTGGAGTCTTTGGA
CGATGGCGGCTTCCGCTTCGAACTCACCGCGTTGAGCGACGACGCGCACATCGAACTCAAGACGTTGATG
GGGCAGGGCGTGCGTCTTGATCTGCAGACCGCGCAAAGCCGTACCGAACTGCGCCCCTTCCACGGGTACG
TGACCGAGGCCGAATGTGTTGCGAGCAACGGCGGCATGGCCCGCTATCGCATCGTCATCGAACCCTGGCT
CGCATTCCTGCGCCTACGCCAGGACAGTTGCCTCTTCCAGCACCAAAGCGTGTTCGACATCGTCGATGCC
GTGTTCACGCGGTACCAAAGCCAGGGCAAGCTGGCCGTGCAATGGCGCTGGGAGATTGCCCAGCGGGACA
TCTATCCCGTGCGCGGCATCACCACCCAGTACCACGAGAGCGATTTCGATTTCGTTGCGCGGCTGCTCGC
CGAAGAAGGCCTGTGCTACTGGTTCGAACACGCCACCGGCAAGGACGGCGACCTGGGCAGCCACACTCTC
GTCATCGCCGACCACAACGGCGCCTTCCGCGCGAACACGCAAGCCACCATCCGCTTTCACCGCGCCGACG
CGAGCGAGCGCGAAGACACCATCCAGCAATGGCGCGGCAGTCGCCAATTGCAGACCAACAGCCTCGCGCA
GCAGAGCTGGGACTACAAGAGCGTGAGCGCCAGGCCCGTGCAGCAGCAAAGCCGCGGCGCAGGCCACCGC
ACCCTGCAGTGGAGCGACGACCCCGGTGCCTACGGTTGGGAGACCTCCGCCCAAGGCGAACGGCTGTTGT
CCAACGCCTTGCAAGCCTTGGAGCTGCGCAACAAACGCTTCGAAGGCCAGAGCGCCGTGCGCAGCCTCGC
ACCCGCCACCACCTTCACGCTGAGCGGCCACGAGCAGCACGACAAGGACGGAGAAGAAGACCGCCGCTTC
GCTGTGCTGGCCGTGCGCCACATCGCGCGCAACAACTTCGACGAAGCCTTGAAGGCCGGTGTCGGTGATC
GCCTCGGACTGCCCGACATCGCCGCCGTGTTCGATGCATCGGAGGACAGCGGCAATGCCGCAGCCAAGCC
CGACACGGTCACTCACTACCGCAACGACTTCACGACAGTGCGCGCGGCCATTCCCTATCGCCCGCTGAGC
ATGGACGGCCACGGCCAGCGCATTCACCCCAAGCCCAGCGTGCACGGCAGCCAGAGCGCCATCGTGATTG
GCGTGGGTGAGAACGCTCCCGTGCACACCGACCGCGACCACCGCGTCAAGGTGCAGTTCCACTGGCAGCG
TGGCAGCGGCTCCAGCGCAAGACAACCCCGCCCCGACGGCCAGGACAATGCGCCCGCCGCGGATCGATTG
GGCGCCTGGGTGCGCGTGGCCGCCAGCGCTGCGGGCGACAACTGGGGCCAGGTCACGCTGCCGCGTGTGG
GGCAGGAGGTGCTGGTCGAATTCCACCATGGCGACATCGACCGCCCCGTCGTCGTTGCGGCCCTCTACAA
CGGTGCTGGGCAGATCGATGCCCAGCACAACGAGAAGTCCGCAGGCGCGGCGCAGTCCACAGGCAACGCC
CCCGCCTGGTTCGCGGGTGAAGGCAAGGAAGCCAAGGAGCACGCGCACAACGCCGTCTTCTCGGGCATCA
AGACCCAGGAGTTGAGTGCCAGCCAGAGCGGTGATGGCGGCTACAACCAGCTGGTCTTCGACGACACGCC
TGGGCAGGGCAGCACGAGCCTCGCGACCACGCAGGCCATGAGCCGGCTGCACCTGGGGCACCACAAGCAG
CAGGACGACAACGCGCGCGGCAAGGCGCGGGGGCATGGAGCGGAGCTGGCGACCACCGCACAGGGTGCCA
TCCGGGCCGGATCTGGATTGCTCGTGAGCGCGCATGCGCAGCAGAACGCCAAGGGTGCGTTCATGGCCAG
TCGCGAGGCGCAGCAGCAGACGAAGCAGGCCGAAGAGCTGGCCACTTCACTCGCGAAGAGTGCGCAGACG
CAGAAGGCGCAGCTCAAAGGTGAAGAGGCGCCGGACAAGCTGCCGGCCATCGAGGCACTGAAGCACGTGG
CCGAGGTGCTCGGGGCGACGCAGGAGGGCGCGTCAGCAAGCGGAGTAAACGGCAGCGGCGGCGACATCAA
AGCCACCGAAGGCGGGCAGGGCAGCGTCACTGCATACAGCGAGCCGCACCTGCAGTTCAGCGCGCCCATG
GGCATCGGCTTCGTCACGCCGAAGGAGGCGATTGCGGTGAGCGGCAAGAACACCGCCATCGTCGCCAACC
AGGACATCGACTTGCCCGCGCAGGGGCAGATCGCGGTGAGCGTAGCCAAGGGGGTGAGCCTGTACACCGT
GGGTGCGAAAGCCGGAGAAGGCGGCGAGCCGAATCAGGAGCGCGGCATCGCGCTGCACGCAGCCAGCGGC
AGCGTGACGCTGCAGAGCCAAAAGGGGGCCACGAAGATCGCGGCCGACAAGAAGGTCACGATCGCCAGCA
CGACGAAGAACGTCGATGTGGAGGCGCCCAAACACGTGCTGCTGACAAGCGCCGGGGCCTACATCAAGCT
CGAGGGCTCGAGCATCAAGATCCATGCGCCGGGGAAGGTGACGTTCAGGGGGATGCACAACTTCGTCGGG
CCGCAAGGGGACAGCAGCAGCAACGCGCTCTCCGGCAGTGACCAGCAACCCTGCCCCAAACAAGACGACG
CCGCGGCCAGCGGCGCCGTCGCCTTTTGA

Protein ID: 319796173
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5547
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6039304..6042438 [+]
Productrhs element vgr protein
NoteTssI
UniProt IDE6VAF8
KEGG IDvpe:Varpa_5547
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-58, Aligned region: 45..363
DUF2345 [PF10106], Evalue: 2.20E-38, Aligned region: 812..970
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 643..753
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 820..841
Phage_base_V [PF04717], Evalue: 2.30E-19, Aligned region: 464..575
Protein Sequence: 1044 a.a.     [Download]
>gi|319796173|ref|YP_004157813.1| rhs element vgr protein [Variovorax paradoxus EPS]
MPSADRSALWAEISQANRLYRLEVPGASTTNASIDALRVEGWVQREAVSQPFEMRIVCLSLRADLALSSM
IDQPLTLITVLANGSTGKRTGLIRAVESLGSDGGLARYRLTLVPWIWLATQQGRSQVFQQRSVADIIERV
LAPYADAGSWAFSSEVSGFLADAPIRTYCTQYRESDFDFFSRLLTEEGLAWRIEEDEKAPLGHKLVIFSA
NDAQPADPGSPIRFHRKSSQERSDAVQALVRRMRQSVAQVHLSAWNVDGKRQLAGSAAARFAVGGKNAPR
IEYDDVLGLNDRSRGWDSNRTLERYAGLMMEAAECRADVMLGHSTVRTLRAGTRIEVDDAPALGLQAKPA
LLLDTVEHVGINNLPKDTAASIAAQLGDLSEHLVFDRPCASVTAEDDVFGLVPTATGSAHDETNDVHPQA
QSLAAAKTLGYANSFSAVHLDRPWRPVLAAADGARLHAKPTASGVHSAIVVGPSGETSPNGADELYCNDR
GDVRVRFHWQTNDSAGGDAQNTGGGDAKDNRSTRWIRVAQRQAGPGMGWQWLPRIGQEVLVKFVDLDVDQ
PVIVGALYNGRGDGGIEPTPGGASRNQEGSASQGQQSDVFAQARNGSPSAQANLAAGHAPAWHGSSADDR
GHRNAAALSGFKTKEFGGEGFSQLVFDDSNQQLRVQLHASTAHSQLNLGHLIHQADNFRGSFRGQGLELR
TDGYAALRGGKGVLLSTYHGAGGKQLEPVGDFAAGMALLKQVQQLGQALSEAAMKHETVQLAGHIGSDKA
NASQLDKERAPYAAMEHTASGMVAGDALETAYSDASDKSIATGDGKVPHTTDAVVALAARGGLAMVAGQQ
LQIVAGETATLASGGDINLALADVLRVHSGQAIGLLAGAQKADAESGLSIIAGSDDLDFQAQHDELRVQA
KDALKIASTDKTVEFAAKKKIRIATAQGASITLQNGDITFECPGKITYHAVQRKLAGPTSLQHPLPANPD
AAPFQRKYVIRRATDNQPIPRQKYRITMDDGRTIEGVSDDKGETEFAKSDGIQNVVIELLYDRA
 
Nucleotide Sequence: 3135 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6039304-6042438 Variovorax paradoxus EPS chromosome, complete genome
ATGCCATCCGCTGACCGCAGCGCGCTCTGGGCCGAGATCAGCCAGGCCAACCGGCTCTACCGTCTCGAGG
TTCCAGGCGCTTCCACAACCAACGCCAGCATCGACGCCCTGCGCGTCGAAGGCTGGGTGCAGCGCGAGGC
CGTGTCGCAGCCGTTCGAGATGCGCATCGTCTGCCTGAGCCTGCGCGCCGATCTCGCGCTCTCGTCGATG
ATCGATCAGCCCCTCACGCTGATCACCGTGCTGGCCAACGGCTCGACCGGCAAGCGTACCGGCCTCATCC
GCGCGGTGGAATCGCTCGGCTCCGACGGCGGCCTCGCACGCTATCGCCTCACGCTCGTGCCATGGATCTG
GCTGGCCACGCAGCAGGGGCGCAGCCAGGTGTTCCAGCAACGCTCGGTGGCCGACATCATCGAGCGTGTG
CTCGCGCCGTATGCCGACGCGGGCAGTTGGGCCTTCTCTTCCGAGGTGAGCGGCTTCCTGGCCGATGCGC
CCATTCGCACCTACTGCACGCAGTACCGCGAGAGCGACTTCGATTTCTTCTCGCGCCTGCTCACCGAAGA
GGGCCTGGCCTGGCGCATCGAGGAAGACGAGAAAGCGCCCCTGGGGCACAAGCTCGTGATCTTCTCGGCG
AACGATGCGCAGCCTGCGGACCCGGGCTCGCCCATCCGCTTTCATCGCAAGAGTTCGCAGGAGCGCAGCG
ATGCCGTGCAGGCGCTGGTGCGCCGCATGCGGCAGTCGGTGGCGCAGGTGCATTTGAGCGCATGGAACGT
CGACGGCAAGCGCCAGTTGGCGGGCAGCGCCGCCGCGCGATTTGCGGTCGGCGGCAAGAACGCACCGCGC
ATCGAGTACGACGACGTGCTCGGCCTGAACGACCGCAGCCGCGGCTGGGACAGCAACCGCACGCTCGAAC
GCTATGCCGGCCTGATGATGGAAGCGGCCGAATGCCGCGCCGACGTGATGCTCGGCCACAGCACCGTGCG
CACGCTGCGCGCGGGCACGCGCATCGAAGTCGACGATGCACCGGCGCTTGGATTGCAGGCGAAGCCCGCG
CTGCTGTTGGACACCGTCGAGCATGTGGGCATCAACAATCTGCCGAAGGACACCGCGGCATCGATTGCTG
CGCAGTTGGGCGATCTGTCGGAGCACCTTGTGTTCGACAGGCCCTGTGCATCCGTCACTGCCGAAGACGA
TGTGTTCGGGCTGGTGCCGACAGCCACGGGCAGCGCGCACGACGAGACGAACGATGTCCATCCGCAAGCG
CAGAGCCTTGCCGCGGCGAAGACGCTTGGCTATGCCAACAGCTTCTCGGCGGTGCATCTGGATCGTCCGT
GGCGGCCCGTGCTCGCGGCCGCCGACGGCGCGCGGCTGCATGCCAAGCCCACGGCCAGCGGCGTGCACAG
CGCGATCGTCGTCGGGCCCTCGGGCGAGACCTCGCCGAACGGCGCGGACGAGCTGTATTGCAACGACCGC
GGCGACGTGCGCGTGCGCTTCCATTGGCAGACCAACGATTCGGCCGGCGGCGATGCGCAGAACACCGGCG
GCGGCGACGCCAAGGACAACCGCAGCACGCGATGGATTCGCGTGGCGCAGCGTCAGGCCGGTCCCGGCAT
GGGCTGGCAGTGGCTGCCGCGTATCGGACAGGAAGTGCTGGTGAAGTTCGTCGACCTCGATGTCGACCAG
CCGGTGATCGTCGGTGCGCTGTACAACGGGCGCGGAGATGGCGGCATCGAGCCTACGCCTGGCGGTGCAT
CGCGCAATCAGGAAGGCTCAGCAAGCCAGGGCCAGCAGAGCGACGTCTTTGCGCAGGCCCGCAATGGATC
GCCGAGCGCGCAGGCCAATCTCGCTGCTGGCCACGCGCCGGCCTGGCACGGTTCGAGCGCGGATGACAGG
GGGCATCGCAACGCTGCGGCGCTGAGCGGCTTCAAGACGAAGGAGTTCGGCGGCGAGGGGTTCAGTCAGC
TGGTATTCGACGATTCGAATCAGCAGTTGCGCGTGCAGCTGCATGCGAGCACGGCGCACAGCCAGTTGAA
CCTCGGACATCTGATTCATCAGGCAGACAACTTCCGCGGGAGCTTCCGCGGACAGGGGCTCGAGCTTCGC
ACCGATGGCTATGCAGCCTTGCGTGGTGGGAAGGGCGTGCTGTTGAGCACGTACCACGGGGCCGGTGGGA
AGCAGCTTGAACCTGTTGGCGACTTTGCTGCGGGCATGGCGTTGCTCAAACAAGTGCAGCAGCTGGGGCA
GGCGCTGAGCGAAGCCGCGATGAAGCACGAGACCGTGCAGCTCGCCGGGCATATCGGTTCCGACAAGGCC
AACGCTTCACAGCTCGACAAGGAGCGCGCACCGTACGCGGCGATGGAGCATACGGCGAGCGGGATGGTGG
CCGGCGATGCGCTGGAGACGGCGTATTCGGATGCGTCGGACAAATCCATAGCTACCGGCGATGGCAAGGT
GCCGCACACGACCGATGCGGTTGTTGCGCTGGCTGCGCGCGGCGGCCTGGCGATGGTTGCGGGGCAGCAA
TTGCAGATCGTGGCGGGTGAGACTGCGACGTTGGCCAGCGGTGGGGATATCAACCTGGCGCTGGCGGATG
TGCTGAGGGTGCATAGCGGGCAGGCTATTGGGCTGCTGGCTGGCGCGCAGAAGGCGGATGCCGAGTCGGG
TCTGTCGATCATTGCGGGCAGCGACGACCTGGATTTTCAGGCGCAGCACGATGAATTGCGGGTGCAAGCC
AAGGATGCGCTGAAGATCGCGAGTACCGACAAGACGGTGGAGTTCGCGGCGAAGAAGAAGATCCGCATTG
CGACCGCGCAAGGCGCGTCGATCACGTTGCAGAACGGGGATATCACGTTTGAATGCCCGGGGAAGATTAC
CTATCACGCGGTGCAGCGGAAGCTGGCGGGGCCGACGAGCCTTCAACATCCCCTTCCCGCAAACCCCGAC
GCCGCGCCGTTCCAGCGCAAATACGTCATTCGACGTGCCACCGACAACCAACCGATTCCTCGCCAGAAGT
ATCGAATCACCATGGACGATGGCCGCACCATCGAAGGCGTCAGCGACGACAAGGGCGAAACGGAATTCGC
CAAGTCCGACGGCATTCAAAACGTGGTGATTGAACTCTTGTACGACCGCGCATGA