SecReT6
Protein ID: 319796154
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5528
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6015843..6018563 [-]
Producttype VI secretion ATPase, clpv1 family
NoteTssH
UniProt IDE6VAD9
KEGG IDvpe:Varpa_5528
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 234..312
AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 636..803
AAA [PF00004], Evalue: 5.40E-19, Aligned region: 235..347
AAA [PF00004], Evalue: 5.40E-19, Aligned region: 641..773
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 235..270
AAA_5 [PF07728], Evalue: 2.20E-13, Aligned region: 640..760
ClpB_D2-small [PF10431], Evalue: 3.50E-12, Aligned region: 811..884
Clp_N [PF02861], Evalue: 4.30E-11, Aligned region: 23..74
Clp_N [PF02861], Evalue: 4.30E-11, Aligned region: 107..130
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 80..80
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 212..258
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 279..313
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 615..679
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 706..729
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 234..321
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 359..387
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 637..661
AAA_22 [PF13401], Evalue: 1.80E-07, Aligned region: 701..734
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 214..314
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 638..758
IstB_IS21 [PF01695], Evalue: 2.90E-05, Aligned region: 220..294
IstB_IS21 [PF01695], Evalue: 2.90E-05, Aligned region: 640..658
AAA_19 [PF13245], Evalue: 3.50E-05, Aligned region: 235..268
AAA_19 [PF13245], Evalue: 3.50E-05, Aligned region: 636..662
AAA_17 [PF13207], Evalue: 6.40E-05, Aligned region: 235..300
AAA_17 [PF13207], Evalue: 6.40E-05, Aligned region: 640..676
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 235..334
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 641..662
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 227..251
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 636..666
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 230..307
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 360..405
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 500..556
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 636..659
Arch_ATPase [PF01637], Evalue: 0.00042, Aligned region: 214..249
Arch_ATPase [PF01637], Evalue: 0.00042, Aligned region: 287..381
Arch_ATPase [PF01637], Evalue: 0.00042, Aligned region: 638..654
Arch_ATPase [PF01637], Evalue: 0.00042, Aligned region: 711..734
SRP54 [PF00448], Evalue: 0.00071, Aligned region: 235..258
SRP54 [PF00448], Evalue: 0.00071, Aligned region: 639..672
AAA_18 [PF13238], Evalue: 0.001, Aligned region: 235..266
AAA_18 [PF13238], Evalue: 0.001, Aligned region: 642..665
DUF2075 [PF09848], Evalue: 0.0023, Aligned region: 235..337
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 235..272
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 640..659
ResIII [PF04851], Evalue: 0.0033, Aligned region: 219..257
ResIII [PF04851], Evalue: 0.0033, Aligned region: 300..316
ResIII [PF04851], Evalue: 0.0033, Aligned region: 612..661
RNA_helicase [PF00910], Evalue: 0.0051, Aligned region: 236..257
RNA_helicase [PF00910], Evalue: 0.0051, Aligned region: 641..662
DUF258 [PF03193], Evalue: 0.0069, Aligned region: 230..254
DUF258 [PF03193], Evalue: 0.0069, Aligned region: 638..652
Protein Sequence: 906 a.a.     [Download]
>gi|319796154|ref|YP_004157794.1| type VI secretion ATPase, clpv1 family [Variovorax paradoxus EPS]
MSTSLKTLITKLNASARMATQRAANLCLANGHYEVDLEHLFLALLEQTDNDLARVLRANRISATAIQSDL
EREIQTFKNGNTRTPVFSQHLQQLFQQAWLLASLDAHVAQIRSGHLLLALLTEPDLAQLAQRGSPLFAKI
RLEDLKHDFDKLTDGSSEAAEAGASGGAATEGDAQQAPADALAAGVPGKTPALDQFTTNLTQRAKDGALD
PVIGRDTEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGLALRIATEDVPESLRAVALHTLDMGLLQAG
ASVKGEFENRLKNVIAEVKKSPHPIVLFIDEAHTMIGAGGQAGQSDAANLLKPALARGELRTIAATTWGE
YKKYFEKDAALARRFQVVKVEEPSETLAAAMLRGMVPLMEKHFNIRVLDEAITEAVRLSHRYISGRQLPD
KAVSVLDTACAKVALGQSATPALIEEANRGLERIEAESAALVRDTAAGGRHEVRLAELAEKKSALQAELA
ASQQRLAEENALVERIRALRAQRDESAAQPEAAPAEKAPARAASRKKSATSADPERDQLDALLAELRALQ
GTTPMVPLQVDGHVVAEIVSAWTGVPLGRMVKDEIKTVRALDTLLAERVIGQDHALAAVAQRVRTASARL
EDPNKPRGVFMFVGPSGVGKTETALALADILYGGEKKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGV
LTEAVRRQPYSVVLLDEVEKAHPDVLEMFFQVFDKGMMDDAEGREIDFRNTLIILTSNIGSSQIMQACLN
KADDERPAPDALADALRPVLMKAFKPAFLGRMKVAPFYPITDAVLEQIIALKLGRIRDRIATNHKAVFEW
DDALVEAVLARCTEVDSGARNVDHILNGTLLPEIAEAVLTRMADETPLAKIKASCAKSGEFRYRIS
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6018563-6015843 Variovorax paradoxus EPS chromosome, complete genome
ATGAGCACATCGCTGAAAACACTGATCACCAAGCTCAACGCCAGCGCACGCATGGCCACGCAGCGCGCGG
CCAATCTGTGCCTGGCCAACGGCCACTACGAAGTGGACCTGGAGCACCTGTTCCTGGCGCTGCTGGAGCA
GACCGACAACGACCTCGCGCGCGTGCTGCGCGCCAACCGCATCAGCGCGACCGCGATCCAGTCGGACCTG
GAGCGCGAGATCCAGACCTTCAAGAACGGCAACACGCGCACGCCGGTGTTCTCGCAGCACCTGCAGCAGT
TGTTTCAGCAGGCGTGGCTCCTGGCCTCGCTCGATGCGCACGTGGCGCAGATCCGCTCGGGCCACCTGCT
GCTCGCGCTGTTGACCGAACCCGACCTCGCACAACTCGCGCAGCGCGGCTCGCCGCTGTTCGCGAAGATC
CGCCTCGAAGACCTGAAGCACGACTTCGACAAGCTCACCGACGGTTCGAGCGAAGCGGCCGAAGCCGGCG
CCTCGGGCGGTGCGGCCACGGAAGGCGACGCGCAGCAAGCGCCGGCCGATGCGCTGGCCGCGGGCGTGCC
CGGCAAGACGCCCGCGCTCGACCAGTTCACCACCAACCTCACGCAGCGCGCGAAAGACGGTGCGCTCGAC
CCGGTGATCGGCCGCGACACCGAGATCCGCCAGGTCATCGACATCCTGATGCGCCGGCGCCAGAACAACC
CCATCCTCACCGGCGAGGCCGGGGTCGGCAAGACGGCGGTGGTCGAGGGGTTGGCGTTGCGCATCGCGAC
AGAGGACGTGCCCGAGTCGCTGCGCGCCGTGGCGCTGCACACGCTGGACATGGGCCTTCTGCAGGCCGGC
GCGAGCGTGAAGGGCGAGTTCGAGAACCGCCTGAAGAACGTGATCGCCGAAGTGAAGAAGAGCCCGCATC
CGATCGTGCTCTTCATCGACGAGGCCCACACGATGATCGGCGCGGGCGGCCAGGCCGGGCAGAGCGATGC
GGCCAACCTGCTCAAGCCCGCGCTCGCGCGCGGCGAACTGCGCACCATCGCCGCCACGACCTGGGGCGAA
TACAAGAAATACTTCGAGAAGGACGCGGCGCTCGCGCGGCGCTTCCAGGTCGTGAAGGTCGAGGAGCCCA
GCGAAACGCTGGCTGCCGCCATGCTGCGCGGCATGGTGCCGCTGATGGAAAAGCACTTCAACATCCGCGT
GCTCGACGAAGCCATCACCGAGGCGGTGCGCCTGTCGCACCGCTACATCAGCGGCCGCCAGCTGCCCGAC
AAGGCGGTGAGCGTGCTCGACACCGCGTGCGCGAAAGTGGCGCTCGGCCAGAGCGCGACGCCGGCGCTGA
TCGAGGAAGCGAATCGCGGCCTCGAACGTATCGAGGCCGAGAGTGCCGCGCTGGTGCGCGACACCGCGGC
CGGCGGGCGCCATGAAGTGCGGCTGGCCGAACTGGCGGAAAAGAAGAGCGCGCTGCAGGCCGAGCTTGCT
GCGAGCCAGCAGCGCCTTGCCGAAGAGAACGCGCTGGTCGAACGCATCCGTGCACTGCGCGCGCAACGCG
ACGAGTCGGCTGCACAGCCCGAGGCTGCACCCGCAGAGAAGGCCCCCGCACGTGCCGCGAGCCGCAAGAA
ATCCGCGACCAGTGCGGACCCCGAACGCGACCAACTCGATGCCCTGCTCGCCGAGCTGCGCGCGCTGCAA
GGCACCACGCCGATGGTTCCACTGCAGGTCGACGGCCACGTCGTCGCCGAGATCGTCTCGGCCTGGACCG
GCGTGCCGCTCGGCCGCATGGTCAAGGACGAAATCAAGACCGTGCGCGCCCTCGATACGCTGCTGGCCGA
ACGCGTGATCGGCCAGGACCACGCGCTCGCCGCCGTCGCCCAGCGCGTGCGCACCGCCAGCGCGCGCCTG
GAAGACCCCAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGCCCCTCGGGCGTGGGCAAGACCGAGACCG
CGCTCGCGTTGGCCGACATCCTCTACGGCGGCGAGAAGAAGCTCATCACCATCAACATGAGCGAGTACCA
GGAGGCGCACAGCGTCTCGGGCCTGAAGGGATCGCCGCCCGGCTACGTGGGTTATGGCGAAGGCGGCGTG
CTCACCGAAGCCGTGCGCCGCCAGCCTTACAGCGTGGTGCTGCTCGACGAAGTCGAGAAGGCGCACCCCG
ATGTGCTGGAGATGTTCTTCCAGGTGTTCGACAAAGGGATGATGGACGACGCCGAGGGCCGCGAGATCGA
CTTTCGCAACACGCTGATCATCCTCACCTCGAACATCGGCTCGTCGCAGATCATGCAGGCGTGCCTGAAC
AAGGCCGACGACGAGCGCCCCGCGCCCGACGCGCTGGCCGATGCGCTGCGCCCCGTGCTCATGAAGGCCT
TCAAGCCGGCCTTTCTCGGCCGCATGAAAGTGGCGCCGTTCTATCCGATCACCGATGCGGTGCTCGAACA
GATCATCGCGCTCAAGCTGGGCCGCATCCGCGACCGCATCGCGACCAACCACAAGGCAGTGTTCGAGTGG
GACGACGCGCTGGTGGAGGCCGTGCTTGCGCGCTGCACCGAGGTCGATTCGGGCGCGCGCAACGTCGATC
ACATCCTGAACGGCACGCTCCTGCCCGAGATCGCGGAAGCGGTGCTCACGCGCATGGCGGACGAGACGCC
GCTCGCGAAGATCAAGGCGAGCTGCGCCAAGAGCGGCGAGTTCCGCTACAGGATCAGCTAG