SecReT6
Protein ID: 319796155
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5529
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6018629..6019750 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE6VAE0
KEGG IDvpe:Varpa_5529
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-87, Aligned region: 18..354
Protein Sequence: 373 a.a.     [Download]
>gi|319796155|ref|YP_004157795.1| type VI secretion protein [Variovorax paradoxus EPS]
MQTPQRRIDPAVADRLLREPYRFEFFQAVRLLELVLLKRQERDVHHRLVPGERMVPRWLRFRSSTSLAFP
PSEIEALAVRDAVGQLVSSAELCEPPVQGEDAHGLGRIELTPASFGMLGVSGALPIVYTEMLMRREQHLR
DSSARAFLDVFTNRATALFYAAWRKYRLPLHYEHERSRAYLPVLLSMAGLEHTAQRDPLTDGTGTVFDET
VAGYAAAVRHRPMSAAYLQRVLSDYFRSNIRIEQFLGKWYDMPEQQRSRLGEGNVSLGQNAMAGERIWQR
DLRIRLWIGPLKRSALREFFPGRAHAKALEKMLALLAGVTCEYEVRLILAREEVAAVQLSDGGGSHLGWD
SFIATGEAESDRSDTQYELQPLQ
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6019750-6018629 Variovorax paradoxus EPS chromosome, complete genome
ATGCAAACCCCGCAGCGGCGAATCGATCCTGCTGTAGCCGACCGGCTGCTGCGCGAACCGTACCGCTTCG
AGTTCTTCCAGGCGGTGCGGTTGCTCGAACTCGTGCTGCTCAAGCGGCAGGAGCGCGACGTGCACCATCG
CCTGGTGCCCGGCGAGCGCATGGTGCCGCGCTGGCTGCGCTTTCGCAGCTCGACGAGCCTTGCCTTCCCG
CCCAGCGAGATCGAGGCACTGGCGGTGCGCGATGCGGTGGGCCAGCTGGTGTCGAGCGCTGAACTGTGCG
AGCCGCCCGTGCAGGGCGAAGACGCGCATGGGCTCGGCCGCATCGAACTCACGCCCGCCTCCTTCGGCAT
GCTGGGCGTGTCGGGTGCCTTGCCCATCGTCTACACCGAGATGCTGATGCGCCGGGAGCAACACCTGCGC
GACAGCTCGGCGCGCGCGTTTCTCGACGTGTTCACCAATCGCGCGACCGCGCTCTTCTATGCGGCCTGGC
GCAAGTACCGCCTGCCGCTGCACTACGAGCACGAACGCAGCCGCGCCTATCTGCCGGTGCTGCTGTCGAT
GGCGGGGCTGGAGCACACGGCCCAGCGCGATCCGCTCACCGACGGCACCGGTACGGTGTTCGACGAAACC
GTGGCCGGCTATGCGGCCGCGGTGCGTCATCGGCCGATGTCGGCTGCGTATCTGCAGCGCGTGCTGTCCG
ACTACTTTCGCAGCAACATCCGCATCGAGCAGTTTCTGGGCAAGTGGTACGACATGCCCGAGCAGCAGCG
CTCGCGCCTAGGGGAAGGCAACGTGAGCCTCGGGCAGAACGCGATGGCGGGAGAACGCATCTGGCAGCGC
GACCTGCGCATCCGCCTGTGGATCGGCCCGCTCAAGCGCAGCGCACTGCGCGAATTCTTCCCGGGCCGCG
CGCATGCGAAGGCGCTCGAAAAAATGCTGGCGCTGCTCGCCGGCGTGACCTGCGAGTACGAGGTGCGATT
GATCCTGGCTCGCGAGGAAGTCGCCGCCGTGCAGCTGAGCGACGGTGGCGGCAGCCATCTCGGCTGGGAC
AGCTTCATCGCCACCGGCGAAGCCGAGAGCGACCGCAGCGACACCCAGTACGAACTCCAGCCCCTGCAGT
AA