SecReT6
Protein ID: 319796156
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5530
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6019714..6021564 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE6VAE1
KEGG IDvpe:Varpa_5530
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-206, Aligned region: 4..616
Protein Sequence: 616 a.a.     [Download]
>gi|319796156|ref|YP_004157796.1| type VI secretion protein [Variovorax paradoxus EPS]
MDELLPFYERELAFLRGYSQEFAKGYPKIAARLAISADSSEDPHVERMIQSFALLTARISKKLDDDYPEL
TEALLEVLYPHYLRPFPSCSIAQFDAGGAALAKLSKPVTIARGTELTSQPVRGGACRFRSVYDVTLAAVQ
VSNVVFHSVVNAPAHASLPRNATGCLSITLEATGEQKSLGTLALTMARLRTFIDAEPSLATALADVIFLK
TAAVFVEPERSGKWTQVQGEALHPVGFDEADALIELPPRSHPAYRLLSEYFAFPEKFNFVDIDLANALRH
IGSCRSITLHLVMTGVRADSPTARLLEGVSSRNLRLGCTPVINLFKQRSDPIRVTHAAAAYPVVADARRA
FGFEVYSIDSVKLVKQTAEGDAYIEFRPFYSLHHGEHPKEAEHYWFARRNELVAQKSPGYETELSIVDID
FQPSLPQTETLSIDLTCTNRDLPHSLAFGLPGGDLFIEGNSVARSIRMLRRPTQTLRMPRGKGVQWRLVS
HLSLNHLSLATSGLPALKEMLRLYDLGRSAVSARQIEAITGIDQQATTQWLPGKPFATFVRGIELKLTVD
EAGFVGSSLQAFARVMDHFFGLYVHLNSFTQLVIVSARDKEELVRCKPRSGESILL
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6021564-6019714 Variovorax paradoxus EPS chromosome, complete genome
ATGGATGAATTGCTGCCCTTCTACGAACGAGAGCTTGCGTTCCTGCGCGGCTACTCGCAAGAGTTCGCCA
AGGGCTACCCCAAGATCGCGGCGCGCCTGGCCATCTCCGCCGACAGCAGCGAGGACCCGCACGTCGAGCG
GATGATCCAGTCGTTCGCGCTGCTCACCGCGCGCATCAGCAAGAAGCTCGACGACGACTACCCCGAGCTC
ACCGAGGCGCTGCTCGAGGTGCTGTACCCGCACTACCTGCGGCCGTTTCCTTCGTGCTCGATCGCGCAGT
TCGATGCCGGCGGCGCGGCGCTCGCGAAGCTGAGCAAGCCCGTCACCATCGCGCGCGGCACCGAGCTCAC
CTCGCAGCCGGTGCGCGGCGGCGCGTGCCGCTTTCGCAGCGTCTACGACGTGACGCTGGCAGCCGTGCAG
GTGTCCAACGTGGTGTTCCATTCGGTGGTGAATGCGCCCGCGCATGCCTCGCTGCCGCGCAACGCCACGG
GATGCCTCTCGATCACGCTCGAAGCCACCGGCGAGCAGAAGTCGCTCGGCACGCTCGCGCTCACCATGGC
GCGCTTGCGCACCTTCATCGACGCCGAGCCCTCGCTCGCCACCGCGCTGGCCGATGTGATCTTCCTGAAG
ACGGCCGCCGTTTTCGTGGAGCCCGAGCGCAGCGGCAAATGGACGCAGGTGCAGGGCGAGGCGCTGCATC
CGGTCGGCTTCGACGAGGCCGATGCGCTCATCGAGCTGCCGCCGCGTTCGCACCCCGCCTACCGGCTGCT
GAGCGAATACTTTGCGTTCCCCGAGAAGTTCAACTTCGTCGACATCGACCTGGCGAACGCGCTGCGCCAC
ATCGGCTCGTGCCGCTCGATCACGCTGCACCTCGTGATGACCGGCGTGCGCGCCGATTCGCCCACGGCGC
GTTTGCTCGAAGGCGTGTCCAGCCGCAACCTGCGCCTGGGCTGCACGCCCGTCATCAACCTCTTCAAGCA
GCGCAGCGATCCGATCCGCGTGACGCACGCCGCGGCCGCATATCCGGTGGTGGCCGATGCGCGCCGGGCC
TTCGGCTTCGAGGTCTACAGCATCGACTCGGTCAAGCTCGTGAAGCAGACCGCCGAGGGCGACGCCTACA
TCGAGTTTCGCCCTTTCTACTCGCTGCATCACGGCGAGCATCCGAAGGAAGCCGAGCACTACTGGTTCGC
GCGGCGCAACGAACTGGTGGCGCAGAAGAGCCCGGGCTACGAGACCGAGCTCTCGATCGTCGACATCGAC
TTCCAGCCCTCGCTGCCGCAAACGGAAACGCTGAGCATCGACCTCACCTGCACCAACCGCGACCTGCCGC
ATTCGCTGGCGTTCGGCCTGCCGGGCGGCGACCTGTTCATCGAGGGCAACTCGGTGGCGCGCTCGATCCG
CATGCTGCGCCGCCCCACGCAGACGCTGCGCATGCCGCGCGGCAAGGGCGTGCAGTGGCGGCTGGTGTCG
CACCTGTCGCTCAACCACCTGTCGCTGGCCACCAGCGGATTGCCGGCACTCAAGGAGATGCTGCGCCTGT
ACGACCTCGGCCGATCCGCCGTGTCGGCGCGGCAGATCGAGGCCATCACCGGCATCGACCAGCAGGCCAC
CACGCAGTGGCTGCCGGGCAAGCCCTTCGCCACCTTCGTGCGCGGCATCGAACTCAAGCTCACGGTCGAC
GAGGCCGGCTTCGTCGGCAGCAGCCTGCAGGCTTTTGCGCGCGTGATGGATCATTTCTTCGGTCTCTATG
TGCACCTGAACAGCTTCACCCAGCTGGTGATCGTTTCGGCGCGCGACAAGGAGGAGCTGGTGCGATGCAA
ACCCCGCAGCGGCGAATCGATCCTGCTGTAG