SecReT6
Protein ID: 319796157
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5531
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6021576..6022067 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE6VAE2
KEGG IDvpe:Varpa_5531
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-17, Aligned region: 30..132
Protein Sequence: 163 a.a.     [Download]
>gi|319796157|ref|YP_004157797.1| type VI secretion system lysozyme-like protein [Variovorax paradoxus EPS]
MNGFEPGLLDKLFDDDWRGPASPVLRHLSLEEVKNMVARDLESLLNTRMVFNDAKLESFPECRRSVMTYG
LSDFSGLSLASHYDRSFICRSLEQAIARHESRLRDVVVTLEVDGQTSTNMLYFGITALLVLPELAEPVNF
DAMLQPTTLQYSITRGTGKSRSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6022067-6021576 Variovorax paradoxus EPS chromosome, complete genome
ATGAATGGATTCGAACCGGGCTTGCTCGACAAACTCTTCGATGACGACTGGCGCGGGCCGGCTTCGCCGG
TGCTCAGGCACCTGTCGCTCGAAGAGGTCAAGAACATGGTCGCGCGCGACCTCGAATCGCTGCTCAACAC
GCGCATGGTCTTCAACGACGCGAAGCTCGAGTCGTTTCCCGAGTGTCGGCGTTCCGTCATGACCTACGGC
CTGAGCGATTTCTCGGGCCTGAGCCTTGCGAGCCACTACGACCGCTCGTTCATCTGCCGCTCGCTGGAGC
AGGCCATTGCCCGCCACGAGTCGCGGCTGCGCGACGTCGTCGTGACGCTCGAGGTCGACGGCCAGACCAG
CACCAACATGCTCTATTTCGGAATCACCGCCCTGCTCGTGCTGCCCGAGCTCGCCGAGCCGGTGAACTTC
GACGCGATGCTGCAGCCCACGACGCTGCAGTACTCGATCACACGCGGCACCGGCAAGAGCCGCTCTGCCT
GA