SecReT6
Protein ID: 319796158
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5532
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6022177..6022689 [-]
Producttype VI secretion system effector, hcp1 family
NoteTssD
UniProt IDE6VAE3
KEGG IDvpe:Varpa_5532
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-43, Aligned region: 5..143
Protein Sequence: 170 a.a.     [Download]
>gi|319796158|ref|YP_004157798.1| type VI secretion system effector, hcp1 family [Variovorax paradoxus EPS]
MKDIYVKFGSPAINGESQDKDHKDWVEVSSWQHSIVQPRSATASTAGGHTAERCEHGEMIFTKDMDVVSP
LLYQHASGGTTFDEVTVQFYRADGEGKRVQYMEIKLKYVLIASVNPKVVSNDVASVPSETFSLKYAAVQW
KYTQQKIGGNQGGNSQGAWSLTKNDKTYSV
 
Nucleotide Sequence: 513 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6022689-6022177 Variovorax paradoxus EPS chromosome, complete genome
ATGAAGGATATCTACGTCAAGTTCGGCAGCCCGGCCATCAACGGCGAGTCGCAGGACAAGGACCACAAGG
ACTGGGTCGAGGTCAGCTCCTGGCAGCACAGCATCGTGCAGCCGCGTTCGGCCACCGCATCGACCGCCGG
CGGCCACACCGCCGAGCGCTGCGAGCACGGCGAAATGATCTTCACCAAGGACATGGACGTGGTCAGCCCG
CTGCTGTATCAGCACGCTTCGGGCGGCACCACCTTCGACGAGGTGACCGTGCAGTTCTACCGCGCCGACG
GCGAAGGCAAGCGCGTGCAGTACATGGAGATCAAGCTCAAGTACGTGCTGATCGCCAGCGTGAACCCGAA
GGTCGTGAGCAACGACGTGGCCAGCGTGCCGAGCGAGACCTTCTCGCTGAAGTACGCCGCCGTGCAGTGG
AAGTACACGCAGCAAAAAATCGGCGGCAACCAGGGCGGCAATTCGCAAGGCGCCTGGAGCCTGACCAAGA
ACGACAAGACCTACTCGGTCTGA