SecReT6
Protein ID: 319796159
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5533
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6022781..6024271 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDE6VAE4
KEGG IDvpe:Varpa_5533
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-190, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|319796159|ref|YP_004157799.1| EvpB family type VI secretion protein [Variovorax paradoxus EPS]
MTAQALSASSGAASPEASVDLLDQIVEKSKVAKSDAEHTRAKDLIGELVSQVLEGSVIVSDNVSAMIDAR
VADLDALISAQLSAVMHAPEFQKLESTWRGLEYLVKETPTGTMLKIKVINATKRDLIRDFKAAVEFDQSA
MFKKVYEEEFGTFGGAPFGALVGDFAVTRQPEDMYFLDQMAHVAAAAHAPFIGAASPELLGLESFDDLGK
PRDMAKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPYHPREGTVVDSFNFVEDVDGTDHSKYLWCN
AAWAFATRLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDEGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFGAQSLQKPKKYNTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAHNV
EQFLNRWIAQYVLLDDNATQEQKAQFPLREASIQVGEVPGRPGVYRAVAFLRPHFQLDELSISLRLVADL
PKSVNK
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6024271-6022781 Variovorax paradoxus EPS chromosome, complete genome
ATGACTGCGCAAGCACTTTCGGCATCCAGCGGTGCCGCCTCGCCTGAAGCTTCGGTCGACCTGCTCGACC
AGATCGTCGAGAAGAGCAAGGTCGCCAAGTCCGACGCCGAGCACACCCGCGCCAAGGACCTCATCGGCGA
ACTGGTCAGCCAGGTGCTCGAAGGCTCGGTGATCGTCTCCGACAACGTCTCGGCCATGATCGACGCCCGC
GTGGCCGATCTGGACGCGCTCATCTCCGCGCAGCTGAGCGCCGTGATGCACGCGCCCGAGTTCCAGAAGC
TCGAGAGCACCTGGCGCGGCCTCGAGTACCTCGTGAAGGAAACGCCCACCGGCACGATGCTCAAGATCAA
GGTCATCAACGCCACCAAGCGCGACCTGATCCGCGACTTCAAGGCGGCCGTCGAGTTCGACCAGAGCGCG
ATGTTCAAGAAGGTCTACGAAGAAGAATTCGGCACCTTCGGCGGTGCGCCCTTCGGCGCACTGGTCGGCG
ACTTCGCCGTCACGCGCCAGCCGGAAGACATGTACTTCCTCGACCAGATGGCGCACGTGGCCGCTGCCGC
CCACGCGCCCTTCATCGGCGCCGCGTCGCCCGAGCTGCTGGGCCTGGAGAGCTTCGACGACCTGGGCAAG
CCGCGCGACATGGCCAAGGTGTTCGACACCGTCGAATACGCCAAGTGGAAGTCGTTCCGCGATTCGGAAG
ACTCGCGCTACGTGGGCCTCACGCTGCCGCGCTTCCTCGGCCGGCTGCCCTATCACCCGCGCGAAGGCAC
GGTGGTCGACAGCTTCAATTTCGTGGAAGACGTCGACGGCACCGACCATTCCAAGTACCTCTGGTGCAAC
GCCGCCTGGGCGTTCGCCACGCGCCTCACGGCCGCGTTCGACGACTTCGGCTGGTGCGCCGCGATCCGCG
GCGTGGAAGGCGGCGGCCTGGTCGAAGACCTGCCCACGCACACCTTCAAGACCGACGAGGGCGAGATCGC
CCTGAAGTGCCCGACCGAGATCGCCATCACCGATCGGCGCGAGAAGGAACTGAGCGACCTGGGCTTCATT
CCGCTCGTGCACTGCAAGAACTCCGACTACGCGGCCTTCTTCGGTGCGCAGTCGCTGCAGAAGCCCAAGA
AGTACAACACCGACAGCGCCAACGCCAACGCGGTGCTCTCGGCGCAGCTGCAGTACATCTTCTCCGTGTC
CCGCATCGCGCACTACCTCAAGGCCATGATGCGCGACAAGATCGGCAGCTTTGCCTCGGCACACAACGTC
GAACAGTTCCTCAATCGCTGGATCGCGCAGTACGTGCTGCTCGACGACAACGCGACGCAGGAACAGAAGG
CGCAATTCCCCTTGCGGGAAGCGTCCATCCAGGTGGGCGAAGTGCCCGGCCGGCCTGGTGTCTACCGTGC
GGTCGCTTTCCTGCGGCCCCACTTTCAACTGGATGAGCTGTCGATTTCACTGCGCTTGGTCGCCGATCTG
CCGAAGTCAGTGAATAAGTAA