SecReT6
Protein ID: 319796160
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5534
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6024274..6024789 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE6VAE5
KEGG IDvpe:Varpa_5534
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-57, Aligned region: 12..165
Protein Sequence: 171 a.a.     [Download]
>gi|319796160|ref|YP_004157800.1| type VI secretion protein [Variovorax paradoxus EPS]
MATKRQSVQKRLQKVRPPRVQLTYDVELGDAIEKKELPFVVGVVADLAGQSEVEQPKLKDRKFVNVDRDN
LDDVMKGLAPRAAYQVENKLDERGGTFGVDLTFNSMDAFSPEAVVDQIEPLKRLLDARTKLADLRNKMAG
NSKLEDLLADVLNNTEQLQRLGQGAGKKDGS
 
Nucleotide Sequence: 516 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6024789-6024274 Variovorax paradoxus EPS chromosome, complete genome
ATGGCGACCAAAAGACAGAGTGTGCAAAAGCGCCTGCAGAAAGTGCGCCCGCCGCGCGTGCAACTCACGT
ACGACGTGGAACTCGGTGACGCCATCGAGAAAAAGGAATTGCCATTCGTCGTTGGCGTGGTCGCCGACCT
GGCTGGCCAGTCCGAGGTCGAGCAGCCCAAGCTGAAGGACCGCAAGTTCGTCAATGTCGACCGCGACAAC
CTGGACGACGTCATGAAGGGCCTGGCCCCGCGCGCGGCCTACCAGGTGGAGAACAAGCTCGACGAGCGCG
GCGGCACCTTCGGCGTCGACCTCACCTTCAATTCGATGGACGCCTTCTCGCCCGAGGCCGTGGTCGACCA
GATCGAGCCGCTCAAGCGCCTGCTCGACGCGCGCACCAAGCTGGCGGACCTGCGCAACAAGATGGCCGGC
AACAGCAAGCTCGAAGACCTGCTGGCCGACGTGCTGAACAACACCGAGCAACTCCAGCGCCTGGGGCAGG
GCGCCGGCAAGAAGGACGGAAGCTGA