SecReT6
Protein ID: 319796162
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5536
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6025813..6026436 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6VAE7
KEGG IDvpe:Varpa_5536
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.70E-33, Aligned region: 14..168
Protein Sequence: 207 a.a.     [Download]
>gi|319796162|ref|YP_004157802.1| type VI secretion lipoprotein [Variovorax paradoxus EPS]
MKIPVTIGALLMTLLLAGCSSPALTIANIALEASGLKKPELPESQKPPRKVSMSIAAGKNLNADSRNRPL
AVVVRIYKLKETTGFYQSSFDAFVTPGRDKTQLGDDLVESREITLIPDQQYTWTETVPRTANAVGVVVLF
HSPDAQRWRFAFNAADAEKTGIVMGAHACALTVTQGAVVGQQNAQGGAATGNALNLLGPVTCRPSPA
 
Nucleotide Sequence: 624 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6025813-6026436 Variovorax paradoxus EPS chromosome, complete genome
ATGAAAATACCAGTCACGATTGGCGCGCTGCTGATGACGCTCCTGCTCGCCGGGTGCAGCTCTCCAGCCC
TCACGATCGCCAACATCGCCCTGGAGGCGAGCGGCCTGAAAAAGCCCGAGTTGCCCGAGTCGCAGAAGCC
GCCGCGCAAGGTGTCGATGTCGATCGCGGCGGGCAAGAACCTCAACGCCGACAGCCGCAACCGACCGCTC
GCCGTGGTGGTGCGCATCTACAAGCTGAAGGAAACGACGGGCTTCTACCAGTCGTCGTTCGATGCCTTCG
TCACCCCCGGACGCGACAAGACGCAACTGGGCGACGACCTCGTCGAGAGCCGCGAGATCACGCTCATTCC
CGACCAGCAATACACATGGACCGAGACCGTGCCGCGCACCGCCAACGCGGTGGGCGTGGTGGTGCTGTTC
CACTCGCCCGACGCCCAGCGCTGGCGCTTCGCCTTCAACGCCGCGGACGCGGAAAAGACCGGCATCGTGA
TGGGCGCGCATGCCTGCGCGCTGACGGTGACGCAGGGCGCGGTGGTCGGTCAGCAGAACGCGCAGGGCGG
CGCCGCGACCGGCAACGCGCTCAACCTGCTGGGCCCGGTGACCTGCCGGCCCTCGCCGGCTTGA