SecReT6
Protein ID: 319796163
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5537
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6026509..6027855 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE6VAE8
KEGG IDvpe:Varpa_5537
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.00E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|319796163|ref|YP_004157803.1| type VI secretion protein [Variovorax paradoxus EPS]
MSYAAKVLWGEGLFLRPQHFQRQDAYHEARLRATAQTLHPYFWGVRSISFDLDALASGMLRASQLSLVFP
DGEPYSAPQADALPPPISLDTLNPGQNEITFYLVLHPVKELGKNYTDPNEEGFAARYTSDATQSLDLFTN
AVSAEVVFLRKSVKLLADTEPREQFVSIPVIRIRRTAAGGFEIDRSFVPPCTSIDASATIFQQLRRLLDV
LQAKVNSLYGIHREPSKNIIEFRSGDIASFWLLHTANSAFASLSHLFHHPSLHPERLFQELLSLAGALMT
FAKTYSLNDLPVYDHEKPGPAFAELDRIVRDLLDTVISTRYFAIALTETRNAFYLGRLDSGKIDEKTVFY
MSVTASMPAAELAEAVPQRFKIGAPEDVDKLVLSAMPGVRIVYAPQVPPAIPIRAGACYFSIDSKSQLYD
RMLQAQSVTIYAPAGIPDMQLELIAVTG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6026509-6027855 Variovorax paradoxus EPS chromosome, complete genome
GTGAGCTATGCCGCCAAGGTCCTCTGGGGAGAGGGCTTGTTTCTACGCCCCCAGCATTTCCAGCGCCAGG
ACGCGTACCACGAGGCACGCTTGCGCGCCACGGCGCAGACGCTGCATCCGTACTTCTGGGGCGTGCGCTC
CATCAGCTTCGACCTGGACGCGCTCGCGAGCGGCATGCTCCGCGCCTCGCAGCTGTCGCTGGTGTTCCCC
GACGGCGAGCCTTACTCGGCACCGCAGGCCGACGCGCTGCCCCCGCCCATCTCGCTCGATACGCTCAACC
CGGGCCAGAACGAGATCACCTTCTACCTGGTGCTGCACCCGGTGAAGGAGCTGGGCAAGAACTACACCGA
CCCGAACGAAGAAGGCTTCGCCGCGCGCTACACCAGCGACGCGACGCAATCGCTCGATCTCTTCACGAAC
GCAGTGAGCGCCGAGGTGGTGTTCCTGCGCAAGAGCGTGAAGCTCCTGGCCGACACCGAGCCGCGCGAGC
AGTTCGTGTCGATCCCGGTGATCCGCATCCGCCGCACCGCCGCGGGCGGTTTCGAAATCGACCGCAGCTT
CGTGCCGCCGTGCACCTCCATCGACGCCTCGGCCACGATCTTCCAGCAGCTGCGGCGGCTCCTGGACGTG
CTGCAGGCCAAGGTCAACTCGCTCTATGGCATTCATCGCGAGCCGAGCAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCCTCGTTCTGGCTGCTGCACACGGCCAACTCGGCATTCGCTTCGCTCTCGCACCTGTT
CCATCACCCGTCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGAGCCTGGCCGGCGCGCTGATGACC
TTTGCGAAGACCTATTCGCTCAACGACCTGCCGGTGTACGACCACGAGAAGCCGGGCCCTGCCTTCGCCG
AACTCGACCGCATCGTGCGCGACCTGCTCGACACGGTGATCTCGACGCGCTACTTCGCGATCGCGCTCAC
CGAAACCCGCAACGCCTTCTACCTCGGGCGCCTGGATTCCGGAAAGATCGACGAGAAGACCGTGTTCTAC
ATGTCGGTCACCGCGAGCATGCCGGCCGCCGAGCTGGCCGAGGCGGTGCCGCAGCGCTTCAAGATCGGCG
CGCCCGAAGACGTCGACAAGCTGGTGCTCTCGGCCATGCCGGGCGTGCGCATCGTCTACGCGCCGCAGGT
GCCGCCGGCCATTCCGATCCGCGCGGGTGCCTGCTACTTCTCCATCGACAGCAAGAGCCAGCTGTACGAC
CGCATGCTTCAGGCGCAGAGCGTCACCATCTACGCGCCGGCCGGCATTCCCGACATGCAGCTCGAACTGA
TTGCCGTGACCGGCTGA