SecReT6
Protein ID: 319796164
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5538
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6027869..6028663 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6VAE9
KEGG IDvpe:Varpa_5538
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-51, Aligned region: 33..233
Protein Sequence: 264 a.a.     [Download]
>gi|319796164|ref|YP_004157804.1| DotU family type IV/VI secretion system protein [Variovorax paradoxus EPS]
MNTTINKAPSLLGADAPAASFTPAGAAPDAGASLLDLLYDGFVMLFLLKKKQQPATTEQFLTGIRNYLGE
FERNARKLDATAEQIHAAKYAFCATIDEFVLSAPEFAIRSEWERRPLQLTLFGDQLAGENFFQMLEVERA
HGAARIQTLEVFYMCLLLGFQGKYAIDGTEKLAYLTARVGDEIANARGKRTPFAPHWPLPDLISHSLKRE
APQWVVAALFALIGLLGFIGLSAHIGSTTQGTLASYQDIVKLGPRQANLTISLP
 
Nucleotide Sequence: 795 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6027869-6028663 Variovorax paradoxus EPS chromosome, complete genome
ATGAACACCACCATCAACAAGGCCCCCTCCCTGCTCGGCGCCGACGCACCCGCCGCGTCGTTCACGCCCG
CGGGCGCCGCCCCCGACGCGGGCGCAAGCCTGCTCGACCTGCTGTACGACGGCTTCGTGATGCTGTTCCT
CTTGAAGAAGAAGCAGCAGCCCGCGACCACCGAGCAGTTCCTCACCGGCATCCGCAATTACCTGGGCGAG
TTCGAGCGCAACGCGCGCAAGCTCGACGCGACGGCCGAGCAGATCCACGCGGCCAAGTACGCCTTTTGCG
CGACCATCGACGAGTTCGTGCTCTCGGCACCCGAGTTCGCGATCCGCTCCGAGTGGGAGCGCCGGCCGCT
GCAGCTCACACTGTTCGGCGACCAGCTGGCCGGCGAGAACTTCTTCCAGATGCTCGAGGTCGAGCGGGCG
CACGGCGCCGCGCGCATCCAGACGCTCGAGGTGTTCTACATGTGCCTCTTGCTGGGCTTCCAGGGCAAGT
ACGCCATCGACGGCACCGAGAAGCTGGCTTATCTCACCGCGCGCGTGGGCGACGAGATCGCCAACGCCCG
CGGCAAGCGCACGCCTTTCGCACCGCACTGGCCGCTGCCCGACCTGATCTCGCACTCGCTCAAGCGCGAG
GCGCCGCAGTGGGTGGTGGCCGCACTGTTCGCGCTCATCGGACTGCTCGGCTTCATCGGCCTCTCGGCCC
ACATCGGCAGCACCACGCAGGGCACGCTCGCGAGCTACCAGGACATCGTGAAGCTCGGCCCGCGCCAGGC
CAACCTGACGATCTCGCTGCCATGA