SecReT6
Protein ID: 319796165
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5539
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6028660..6029790 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDE6VAF0
KEGG IDvpe:Varpa_5539
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-25, Aligned region: 57..118
Protein Sequence: 376 a.a.     [Download]
>gi|319796165|ref|YP_004157805.1| ImpA family type VI secretion-associated protein [Variovorax paradoxus EPS]
MTTRLDLPALLAPISEASPCGEDMLFSRQFDAIQEARKHDDPSLEQGEWVIELKEANWPFVISECEKLLR
DSTKDLRLAVWLTDALASQRGFEGLADGYRLLTGLCQQYWDQLHPLPEGGDIEMRVGNVTWLIGRSVELL
QRAPIVSDAHTGYGALVWETALALDQSIRRTPAQADELQRNKVTVEQFDRIRRATPAKFLQKTHRDVQAC
EQALAEFEAVFDERTASNGPSFRAAKDAAAAIRQTVERFAREAGVPMDSGAPTAPAAAPAAAGTPAPSRI
EPVFDAVVPHHAPAAAPAALPPGIHSRAQAIAQLKEVAAYFEKTEPSSPAAYMANKAARWADMPLHAWLR
NVIKNEQELAQLVDLLDLPKNDDESR
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6028660-6029790 Variovorax paradoxus EPS chromosome, complete genome
ATGACGACGCGGCTCGACCTGCCGGCCCTGCTGGCCCCGATCTCGGAAGCCTCGCCCTGCGGCGAGGACA
TGCTGTTCTCGCGGCAGTTCGACGCCATTCAAGAGGCGCGCAAGCACGACGACCCGTCGCTCGAGCAGGG
CGAGTGGGTCATCGAGCTGAAGGAAGCCAACTGGCCCTTCGTGATCTCCGAGTGCGAGAAGCTGCTGCGC
GACTCCACCAAGGACCTGCGGCTTGCCGTGTGGCTCACCGACGCGCTGGCCAGCCAGCGCGGCTTCGAGG
GCCTGGCCGATGGCTACCGCCTGCTCACCGGCCTCTGCCAGCAGTACTGGGACCAGCTGCATCCGCTGCC
CGAGGGCGGCGACATCGAGATGCGCGTGGGCAACGTCACGTGGCTGATCGGGCGTTCCGTCGAACTGCTG
CAGCGCGCGCCCATCGTGAGCGATGCCCACACCGGCTACGGCGCACTGGTCTGGGAGACCGCACTCGCGC
TCGACCAGAGCATCCGCCGCACGCCCGCGCAGGCCGACGAGTTGCAGCGCAACAAGGTGACGGTCGAGCA
ATTCGACCGCATCCGCCGCGCAACGCCCGCCAAGTTCCTGCAGAAGACGCATCGCGACGTGCAGGCCTGC
GAGCAGGCGCTGGCCGAGTTCGAGGCCGTGTTCGACGAACGCACCGCCTCCAACGGCCCGAGTTTCCGCG
CCGCCAAGGATGCGGCCGCGGCCATCCGCCAGACGGTCGAGCGCTTCGCGCGCGAAGCAGGCGTGCCGAT
GGACAGCGGCGCGCCGACCGCGCCCGCAGCAGCGCCGGCCGCCGCCGGTACGCCCGCGCCCTCGCGCATC
GAGCCGGTGTTCGATGCCGTGGTGCCGCATCACGCGCCGGCGGCGGCACCCGCCGCGCTGCCGCCCGGCA
TCCACAGCCGCGCACAGGCCATTGCCCAGCTCAAGGAAGTGGCGGCGTATTTCGAGAAGACCGAGCCTTC
GAGCCCCGCTGCCTACATGGCGAACAAGGCCGCGCGTTGGGCCGACATGCCGCTGCACGCGTGGCTGCGC
AACGTGATCAAGAACGAGCAGGAACTGGCCCAGTTGGTGGACCTGCTCGACCTGCCCAAGAACGACGACG
AGTCGCGCTGA