SecReT6
Protein ID: 319796166
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5540
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6029830..6030651 [-]
Productompa/motb domain-containing protein
NoteTagL
UniProt IDE6VAF1, E6VAF1
KEGG IDvpe:Varpa_5540
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.50E-24, Aligned region: 125..125
OmpA [PF00691], Evalue: 2.50E-24, Aligned region: 170..264
BON [PF04972], Evalue: 1.50E-05, Aligned region: 40..80
BON [PF04972], Evalue: 1.50E-05, Aligned region: 118..133
Protein Sequence: 273 a.a.     [Download]
>gi|319796166|ref|YP_004157806.1| ompa/motb domain-containing protein [Variovorax paradoxus EPS]
MKSYLRVLSFTLGLVMVGAVQAQTAAAPGARVETTPAASAKGEQVVAGGQVPDEATRVAVIEALRRIYGP
SGVVDKIEVVNTVSMPANWSANVQRLITPALKDIHRGQFQIEGTQMALSGEVGNEALRQKIVSDMANSLN
PTYTIKNSLRVPVSEQITVDQALANRTIEFELGSATLTRKGRDILDEMAPILQKLTNKSVAVIGHTDNAG
SRASNLALSQSRAEAVKGYLVGKGIDPMTLTTSGVGPDQPVANNATDEGRSRNRRIEFRVGRT
 
Nucleotide Sequence: 822 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6030651-6029830 Variovorax paradoxus EPS chromosome, complete genome
ATGAAAAGTTATTTGCGCGTTTTGTCGTTCACCCTGGGTCTCGTAATGGTCGGCGCCGTGCAGGCCCAGA
CGGCAGCCGCTCCCGGCGCCCGGGTCGAAACCACGCCAGCGGCCAGCGCCAAGGGCGAGCAGGTCGTGGC
CGGCGGGCAGGTGCCCGACGAGGCCACGCGCGTCGCCGTCATCGAGGCGCTGCGTCGCATCTACGGGCCG
AGCGGCGTTGTCGACAAGATCGAGGTGGTGAACACCGTGAGCATGCCCGCCAACTGGTCGGCCAATGTGC
AGCGGCTGATCACGCCCGCGCTCAAGGACATCCATCGCGGGCAGTTCCAGATCGAGGGCACGCAGATGGC
GTTGAGCGGCGAGGTCGGCAACGAAGCGCTGCGCCAGAAGATCGTGAGCGACATGGCCAATTCGCTCAAC
CCGACCTACACCATCAAGAACAGCCTGCGCGTGCCGGTGTCGGAGCAGATCACGGTCGACCAGGCGCTGG
CCAACCGCACCATCGAGTTCGAACTGGGCAGCGCCACGCTCACGCGCAAGGGCCGAGACATCCTCGACGA
AATGGCGCCGATCCTGCAGAAGCTCACGAACAAGTCGGTGGCGGTGATCGGCCACACCGACAACGCCGGC
AGCCGGGCGTCGAACCTGGCGCTGAGCCAGTCGCGCGCCGAGGCGGTGAAGGGTTATCTCGTGGGCAAGG
GGATCGATCCGATGACGCTCACGACCTCGGGCGTCGGTCCGGATCAGCCGGTGGCGAACAACGCGACCGA
CGAAGGCCGCTCACGCAACCGGCGCATCGAGTTCCGGGTCGGGCGGACCTGA