SecReT6
Protein ID: 319796170
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5544
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6037102..6037395 [-]
Productpaar repeat-containing protein
NotePAAR
UniProt IDE6VAF5
KEGG IDvpe:Varpa_5544
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.80E-23, Aligned region: 18..90
BACON [PF13004], Evalue: 0.0022, Aligned region: 7..44
Protein Sequence: 97 a.a.     [Download]
>gi|319796170|ref|YP_004157810.1| paar repeat-containing protein [Variovorax paradoxus EPS]
MEEDQPTADNDRPWIVLHDKTDHGGIVITASENTSIDERRVARIGDLVSCPRPGHGINPIVTGSRYVMLD
GRYVARHGDKARCGCTLLSSQIASASE
 
Nucleotide Sequence: 294 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6037395-6037102 Variovorax paradoxus EPS chromosome, complete genome
ATGGAAGAGGATCAACCCACCGCGGACAACGATCGTCCGTGGATCGTCCTGCACGACAAGACCGACCACG
GCGGCATCGTGATCACCGCGTCCGAGAACACGAGCATCGACGAGCGCCGCGTCGCACGCATCGGCGACCT
CGTGTCGTGTCCGCGGCCCGGCCACGGCATCAACCCCATCGTGACCGGCAGCCGCTACGTCATGCTCGAC
GGCCGGTACGTTGCGCGGCATGGCGACAAGGCCCGCTGCGGCTGCACGTTGCTCTCCAGCCAGATCGCTT
CCGCATCCGAATGA