SecReT6
Protein ID: 319796173
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5547
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6039304..6042438 [+]
Productrhs element vgr protein
NoteTssI
UniProt IDE6VAF8
KEGG IDvpe:Varpa_5547
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-58, Aligned region: 45..363
DUF2345 [PF10106], Evalue: 2.20E-38, Aligned region: 812..970
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 643..753
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 820..841
Phage_base_V [PF04717], Evalue: 2.30E-19, Aligned region: 464..575
Protein Sequence: 1044 a.a.     [Download]
>gi|319796173|ref|YP_004157813.1| rhs element vgr protein [Variovorax paradoxus EPS]
MPSADRSALWAEISQANRLYRLEVPGASTTNASIDALRVEGWVQREAVSQPFEMRIVCLSLRADLALSSM
IDQPLTLITVLANGSTGKRTGLIRAVESLGSDGGLARYRLTLVPWIWLATQQGRSQVFQQRSVADIIERV
LAPYADAGSWAFSSEVSGFLADAPIRTYCTQYRESDFDFFSRLLTEEGLAWRIEEDEKAPLGHKLVIFSA
NDAQPADPGSPIRFHRKSSQERSDAVQALVRRMRQSVAQVHLSAWNVDGKRQLAGSAAARFAVGGKNAPR
IEYDDVLGLNDRSRGWDSNRTLERYAGLMMEAAECRADVMLGHSTVRTLRAGTRIEVDDAPALGLQAKPA
LLLDTVEHVGINNLPKDTAASIAAQLGDLSEHLVFDRPCASVTAEDDVFGLVPTATGSAHDETNDVHPQA
QSLAAAKTLGYANSFSAVHLDRPWRPVLAAADGARLHAKPTASGVHSAIVVGPSGETSPNGADELYCNDR
GDVRVRFHWQTNDSAGGDAQNTGGGDAKDNRSTRWIRVAQRQAGPGMGWQWLPRIGQEVLVKFVDLDVDQ
PVIVGALYNGRGDGGIEPTPGGASRNQEGSASQGQQSDVFAQARNGSPSAQANLAAGHAPAWHGSSADDR
GHRNAAALSGFKTKEFGGEGFSQLVFDDSNQQLRVQLHASTAHSQLNLGHLIHQADNFRGSFRGQGLELR
TDGYAALRGGKGVLLSTYHGAGGKQLEPVGDFAAGMALLKQVQQLGQALSEAAMKHETVQLAGHIGSDKA
NASQLDKERAPYAAMEHTASGMVAGDALETAYSDASDKSIATGDGKVPHTTDAVVALAARGGLAMVAGQQ
LQIVAGETATLASGGDINLALADVLRVHSGQAIGLLAGAQKADAESGLSIIAGSDDLDFQAQHDELRVQA
KDALKIASTDKTVEFAAKKKIRIATAQGASITLQNGDITFECPGKITYHAVQRKLAGPTSLQHPLPANPD
AAPFQRKYVIRRATDNQPIPRQKYRITMDDGRTIEGVSDDKGETEFAKSDGIQNVVIELLYDRA
 
Nucleotide Sequence: 3135 bp     [Download]
>gi|319790694|ref|NC_014931.1|:6039304-6042438 Variovorax paradoxus EPS chromosome, complete genome
ATGCCATCCGCTGACCGCAGCGCGCTCTGGGCCGAGATCAGCCAGGCCAACCGGCTCTACCGTCTCGAGG
TTCCAGGCGCTTCCACAACCAACGCCAGCATCGACGCCCTGCGCGTCGAAGGCTGGGTGCAGCGCGAGGC
CGTGTCGCAGCCGTTCGAGATGCGCATCGTCTGCCTGAGCCTGCGCGCCGATCTCGCGCTCTCGTCGATG
ATCGATCAGCCCCTCACGCTGATCACCGTGCTGGCCAACGGCTCGACCGGCAAGCGTACCGGCCTCATCC
GCGCGGTGGAATCGCTCGGCTCCGACGGCGGCCTCGCACGCTATCGCCTCACGCTCGTGCCATGGATCTG
GCTGGCCACGCAGCAGGGGCGCAGCCAGGTGTTCCAGCAACGCTCGGTGGCCGACATCATCGAGCGTGTG
CTCGCGCCGTATGCCGACGCGGGCAGTTGGGCCTTCTCTTCCGAGGTGAGCGGCTTCCTGGCCGATGCGC
CCATTCGCACCTACTGCACGCAGTACCGCGAGAGCGACTTCGATTTCTTCTCGCGCCTGCTCACCGAAGA
GGGCCTGGCCTGGCGCATCGAGGAAGACGAGAAAGCGCCCCTGGGGCACAAGCTCGTGATCTTCTCGGCG
AACGATGCGCAGCCTGCGGACCCGGGCTCGCCCATCCGCTTTCATCGCAAGAGTTCGCAGGAGCGCAGCG
ATGCCGTGCAGGCGCTGGTGCGCCGCATGCGGCAGTCGGTGGCGCAGGTGCATTTGAGCGCATGGAACGT
CGACGGCAAGCGCCAGTTGGCGGGCAGCGCCGCCGCGCGATTTGCGGTCGGCGGCAAGAACGCACCGCGC
ATCGAGTACGACGACGTGCTCGGCCTGAACGACCGCAGCCGCGGCTGGGACAGCAACCGCACGCTCGAAC
GCTATGCCGGCCTGATGATGGAAGCGGCCGAATGCCGCGCCGACGTGATGCTCGGCCACAGCACCGTGCG
CACGCTGCGCGCGGGCACGCGCATCGAAGTCGACGATGCACCGGCGCTTGGATTGCAGGCGAAGCCCGCG
CTGCTGTTGGACACCGTCGAGCATGTGGGCATCAACAATCTGCCGAAGGACACCGCGGCATCGATTGCTG
CGCAGTTGGGCGATCTGTCGGAGCACCTTGTGTTCGACAGGCCCTGTGCATCCGTCACTGCCGAAGACGA
TGTGTTCGGGCTGGTGCCGACAGCCACGGGCAGCGCGCACGACGAGACGAACGATGTCCATCCGCAAGCG
CAGAGCCTTGCCGCGGCGAAGACGCTTGGCTATGCCAACAGCTTCTCGGCGGTGCATCTGGATCGTCCGT
GGCGGCCCGTGCTCGCGGCCGCCGACGGCGCGCGGCTGCATGCCAAGCCCACGGCCAGCGGCGTGCACAG
CGCGATCGTCGTCGGGCCCTCGGGCGAGACCTCGCCGAACGGCGCGGACGAGCTGTATTGCAACGACCGC
GGCGACGTGCGCGTGCGCTTCCATTGGCAGACCAACGATTCGGCCGGCGGCGATGCGCAGAACACCGGCG
GCGGCGACGCCAAGGACAACCGCAGCACGCGATGGATTCGCGTGGCGCAGCGTCAGGCCGGTCCCGGCAT
GGGCTGGCAGTGGCTGCCGCGTATCGGACAGGAAGTGCTGGTGAAGTTCGTCGACCTCGATGTCGACCAG
CCGGTGATCGTCGGTGCGCTGTACAACGGGCGCGGAGATGGCGGCATCGAGCCTACGCCTGGCGGTGCAT
CGCGCAATCAGGAAGGCTCAGCAAGCCAGGGCCAGCAGAGCGACGTCTTTGCGCAGGCCCGCAATGGATC
GCCGAGCGCGCAGGCCAATCTCGCTGCTGGCCACGCGCCGGCCTGGCACGGTTCGAGCGCGGATGACAGG
GGGCATCGCAACGCTGCGGCGCTGAGCGGCTTCAAGACGAAGGAGTTCGGCGGCGAGGGGTTCAGTCAGC
TGGTATTCGACGATTCGAATCAGCAGTTGCGCGTGCAGCTGCATGCGAGCACGGCGCACAGCCAGTTGAA
CCTCGGACATCTGATTCATCAGGCAGACAACTTCCGCGGGAGCTTCCGCGGACAGGGGCTCGAGCTTCGC
ACCGATGGCTATGCAGCCTTGCGTGGTGGGAAGGGCGTGCTGTTGAGCACGTACCACGGGGCCGGTGGGA
AGCAGCTTGAACCTGTTGGCGACTTTGCTGCGGGCATGGCGTTGCTCAAACAAGTGCAGCAGCTGGGGCA
GGCGCTGAGCGAAGCCGCGATGAAGCACGAGACCGTGCAGCTCGCCGGGCATATCGGTTCCGACAAGGCC
AACGCTTCACAGCTCGACAAGGAGCGCGCACCGTACGCGGCGATGGAGCATACGGCGAGCGGGATGGTGG
CCGGCGATGCGCTGGAGACGGCGTATTCGGATGCGTCGGACAAATCCATAGCTACCGGCGATGGCAAGGT
GCCGCACACGACCGATGCGGTTGTTGCGCTGGCTGCGCGCGGCGGCCTGGCGATGGTTGCGGGGCAGCAA
TTGCAGATCGTGGCGGGTGAGACTGCGACGTTGGCCAGCGGTGGGGATATCAACCTGGCGCTGGCGGATG
TGCTGAGGGTGCATAGCGGGCAGGCTATTGGGCTGCTGGCTGGCGCGCAGAAGGCGGATGCCGAGTCGGG
TCTGTCGATCATTGCGGGCAGCGACGACCTGGATTTTCAGGCGCAGCACGATGAATTGCGGGTGCAAGCC
AAGGATGCGCTGAAGATCGCGAGTACCGACAAGACGGTGGAGTTCGCGGCGAAGAAGAAGATCCGCATTG
CGACCGCGCAAGGCGCGTCGATCACGTTGCAGAACGGGGATATCACGTTTGAATGCCCGGGGAAGATTAC
CTATCACGCGGTGCAGCGGAAGCTGGCGGGGCCGACGAGCCTTCAACATCCCCTTCCCGCAAACCCCGAC
GCCGCGCCGTTCCAGCGCAAATACGTCATTCGACGTGCCACCGACAACCAACCGATTCCTCGCCAGAAGT
ATCGAATCACCATGGACGATGGCCGCACCATCGAAGGCGTCAGCGACGACAAGGGCGAAACGGAATTCGC
CAAGTCCGACGGCATTCAAAACGTGGTGATTGAACTCTTGTACGACCGCGCATGA