SecReT6
Protein ID: 319955220
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3740
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4280786..4282648 [-]
Producthypothetical protein
NoteTssF
UniProt IDE6XAM7
KEGG IDcao:Celal_3740
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 620 a.a.     [Download]
>gi|319955220|ref|YP_004166487.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MKSLSKEEIKERLIRRAADTWGMDEMEIEYSLDPIISILFDACSHEFERISDTIKSSRTRITERLVDLLT
PQVSVTARPAHAVMHALPIDSNLNINERSEFYHRKRMPIFRENGKNDFEDFFFAPAGAFKLSNCSLDYIA
YPEKIASHKAHRNIPFISKDNFVGTPDGSSIYLGIKPDEETSSIQDLLCYFDLLNFSQKNVLTHQLGLSK
WSLNGTPLEVVNGYNELEFAGQDLNTYINESIQSKIKFYENYVKEFYQEHFYTITDTISVKDNLKDYPED
FENFLSEKDLKEFNTPLLWIKISFSSIVSSKMLDNLHCHINCFPVLNKKRHETNRRLKSYFNILPLEIDG
DYFFDVQDIIGDSGNTYFIQDRKKEDTSTSTQAYLRFGGVSRFDERDASELLNYTIDLLKEDSIAFNAMN
DDFINTNLKDLKQIISRIDQQIELRDFTKNKIPYLVINKNSINKNKDQFVFTNYWSTAGDKANKINPYVQ
LVQYSGTAFLPNSLTFITGTIGGKDEPSASEKIYAYREHILSKGKIITRQDIIQHCFGIFKDSIKKVTIE
KGVVVALEEGIGYTPTTDVYITKHEDAVYDEESWEHLKKEVLIGLQSRSANVLPFRIFYS
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|319951593|ref|NC_014934.1|:c4282648-4280786 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGAAATCATTAAGTAAAGAAGAAATAAAAGAACGGTTAATTAGAAGGGCTGCGGATACCTGGGGAATGG
ATGAAATGGAAATTGAATATTCCTTAGACCCTATTATTAGTATTCTTTTTGACGCTTGCTCACATGAGTT
TGAACGTATTTCTGATACTATAAAATCTAGTAGAACCAGAATTACGGAGCGTTTAGTAGATTTGCTAACA
CCGCAAGTATCGGTAACTGCAAGACCAGCACATGCTGTGATGCATGCCTTACCTATAGATAGTAATTTAA
ATATTAATGAACGTTCAGAGTTTTACCACCGTAAAAGAATGCCAATTTTTAGGGAGAATGGTAAAAACGA
TTTTGAAGATTTTTTCTTCGCTCCTGCAGGAGCTTTTAAACTGAGTAATTGCTCTTTAGATTACATTGCT
TATCCAGAAAAAATAGCGTCACATAAGGCACACCGGAATATACCTTTTATCTCGAAAGATAATTTTGTAG
GTACTCCAGACGGTTCTAGCATCTACTTAGGAATTAAACCAGATGAAGAAACCAGTTCTATTCAAGACCT
TCTTTGTTATTTTGATTTGCTTAATTTTTCGCAAAAAAATGTATTAACCCACCAATTAGGACTTTCTAAA
TGGTCATTAAACGGTACACCCCTAGAGGTTGTTAATGGCTATAACGAGTTAGAATTTGCTGGTCAAGATT
TAAATACCTATATAAACGAATCTATACAGAGTAAGATTAAATTTTACGAAAACTATGTGAAGGAGTTTTA
CCAAGAGCACTTCTATACAATCACAGATACCATTTCAGTAAAAGATAATTTAAAAGATTATCCCGAAGAT
TTTGAAAATTTTCTTAGTGAGAAAGATTTAAAAGAATTTAATACGCCATTGCTATGGATCAAAATTTCTT
TTTCTTCTATTGTTTCTAGCAAAATGCTAGACAACCTTCATTGCCATATTAACTGTTTTCCTGTACTTAA
TAAAAAGCGACATGAAACCAACAGACGTTTAAAATCTTATTTTAATATTTTACCTTTAGAGATAGACGGG
GATTACTTCTTTGATGTGCAAGATATTATAGGAGACAGTGGTAATACATATTTTATTCAAGACAGAAAGA
AAGAAGATACATCTACAAGTACACAAGCTTATTTACGTTTTGGCGGTGTTTCTCGTTTTGATGAGCGCGA
TGCTTCCGAGCTATTAAATTACACGATAGATTTACTTAAAGAAGATAGCATTGCATTTAATGCAATGAAT
GATGATTTTATCAATACCAACTTAAAAGATCTAAAACAGATAATTTCTAGAATTGATCAGCAAATAGAAT
TGAGAGATTTTACCAAAAATAAAATTCCATATCTAGTTATCAATAAGAATAGCATTAACAAAAATAAAGA
TCAATTTGTTTTTACCAATTATTGGAGCACAGCAGGAGATAAAGCTAATAAAATAAACCCATATGTACAA
TTGGTTCAATATTCGGGTACTGCATTTTTACCAAATTCACTAACTTTTATTACCGGTACTATCGGTGGTA
AAGATGAACCTAGTGCTAGTGAAAAAATTTATGCCTATAGAGAGCACATTCTTTCTAAAGGTAAAATTAT
TACAAGACAGGATATCATTCAGCATTGCTTTGGTATTTTTAAAGATAGCATTAAAAAAGTAACTATAGAA
AAAGGTGTTGTCGTTGCGCTTGAAGAAGGCATTGGCTATACTCCTACTACAGATGTTTACATTACAAAAC
ATGAAGATGCTGTTTACGATGAAGAAAGCTGGGAACACCTAAAAAAAGAAGTACTTATCGGACTCCAATC
GCGATCTGCAAATGTGCTTCCATTTCGTATTTTTTATAGCTAA