SecReT6
Protein ID: 319955221
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3741
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4282663..4283094 [-]
Productgpw/gp25 family protein
NoteTssE
UniProt IDE6XAM8
KEGG IDcao:Celal_3741
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-09, Aligned region: 23..126
Protein Sequence: 143 a.a.     [Download]
>gi|319955221|ref|YP_004166488.1| gpw/gp25 family protein [Cellulophaga algicola DSM 14237]
MAKPYYEAPFDFKRFFEKKELRKISLQESISQFISIIITTYFEEYVFDEGFGSEIWETDFDLLVNANVLK
EQIKRSLTNQIETYEKRLGNTTLTINLQESVSENSNKVRLKKYLNITVTGTLLKTNEPYYFSGDYYLAPL
SYK
 
Nucleotide Sequence: 432 bp     [Download]
>gi|319951593|ref|NC_014934.1|:c4283094-4282663 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGGCAAAACCATACTACGAAGCTCCTTTTGATTTTAAGCGGTTTTTTGAGAAGAAAGAACTTCGGAAAA
TATCGCTACAAGAATCTATATCACAATTTATAAGCATCATCATCACAACATATTTTGAAGAATATGTTTT
TGATGAAGGTTTTGGTAGTGAAATATGGGAAACAGATTTTGATCTGTTGGTGAATGCCAATGTATTAAAA
GAGCAAATTAAAAGATCGCTTACCAATCAAATAGAAACCTATGAAAAGCGCTTAGGGAATACCACTTTGA
CTATTAATTTGCAAGAAAGTGTATCTGAAAATTCGAATAAAGTTAGATTGAAAAAATATCTAAATATTAC
AGTTACAGGTACCCTTTTAAAAACTAACGAACCGTATTATTTTAGTGGTGATTATTATCTAGCACCATTA
TCTTATAAGTAA