SecReT6
Protein ID: 319955224
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3744
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4286098..4287240 [-]
Producthypothetical protein
NoteTssK
UniProt IDE6XAN1, E6XAN1
KEGG IDcao:Celal_3744
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0009, Aligned region: 22..119
DUF876 [PF05936], Evalue: 0.0009, Aligned region: 164..203
Protein Sequence: 380 a.a.     [Download]
>gi|319955224|ref|YP_004166491.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MIEDIKHFKTNWIDGMKISKEHFQNLQDYAENTVKDLTSIRVGKDGFGLLASHLSDHNEYTVTIDVHKSL
KISIKKLRAITPNGTRVEITNLTPAVKEDVVVEQFADNKLEEGFVLLNVDQEDTVAFGEQNPKEMPPRYP
YTTNRYFFTFVTANDLEKSGLAGNQLPIAKIIRENNALAAATDYIAPSITLGTSEALIDFYNVAEAFLKM
AERSSILIVQKINTKQSDNPIADSMHTVVDKLYAYLSQQITYVKWEEYEMHPKKLIEIIVSFSRLFKSAV
DVSSPENKEQLFNYFGEWTDLKGGDYEKIFTNIINIDYNHNDVNQNLFIINSFMNVIERLFTILTQVDYI
GKRRDMGIFVNENIVQDKFGKSGGPSFLAE
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|319951593|ref|NC_014934.1|:c4287240-4286098 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGATAGAGGACATAAAACATTTTAAAACAAATTGGATCGATGGTATGAAAATCTCAAAAGAGCATTTTC
AAAACCTCCAAGACTATGCAGAAAACACTGTAAAAGATCTTACTAGCATTAGGGTAGGAAAAGATGGTTT
TGGTTTATTAGCATCACATTTGAGTGATCATAATGAATATACCGTTACCATTGATGTACATAAAAGTTTA
AAAATATCAATTAAAAAATTACGCGCTATTACCCCAAATGGTACTCGCGTAGAAATTACCAACCTTACGC
CTGCCGTTAAAGAAGATGTTGTTGTAGAACAATTTGCAGATAATAAGTTAGAGGAAGGTTTTGTTTTATT
AAATGTAGATCAAGAAGATACGGTTGCTTTTGGAGAACAAAACCCAAAAGAAATGCCGCCAAGATATCCA
TATACTACCAATAGGTATTTTTTCACTTTTGTAACCGCAAATGATTTAGAAAAGTCGGGTCTTGCAGGAA
ACCAACTTCCTATTGCTAAAATTATTAGAGAAAATAATGCTTTAGCAGCAGCTACAGATTATATTGCTCC
TTCTATTACTTTAGGTACTAGTGAGGCTTTAATAGATTTTTATAATGTAGCAGAAGCTTTCTTAAAGATG
GCAGAACGTAGTTCTATCTTAATTGTGCAAAAAATAAATACAAAACAGAGCGATAATCCTATTGCAGATT
CTATGCATACTGTGGTAGATAAATTATATGCCTATTTATCACAACAGATTACCTATGTAAAATGGGAAGA
ATATGAAATGCACCCTAAAAAACTAATTGAAATTATTGTTAGCTTTTCAAGACTTTTCAAAAGCGCTGTA
GATGTATCATCTCCTGAAAATAAAGAACAGTTATTCAACTATTTTGGGGAGTGGACTGATTTAAAAGGTG
GTGATTATGAAAAAATATTTACAAATATTATCAATATTGATTACAACCATAATGATGTCAATCAAAACTT
ATTTATCATAAATTCTTTCATGAATGTTATCGAACGTTTGTTTACGATACTTACTCAGGTAGATTATATT
GGTAAACGTAGAGATATGGGCATATTTGTTAATGAAAATATCGTACAAGATAAATTTGGAAAATCTGGAG
GACCTTCATTTTTAGCTGAATAA