SecReT6
Protein ID: 319955225
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3745
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4287249..4288070 [-]
Producthypothetical protein
NoteTssN
UniProt IDE6XAN2
KEGG IDcao:Celal_3745
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 273 a.a.     [Download]
>gi|319955225|ref|YP_004166492.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MPFMIIVVITVLILTLFASKTPGFKKQRKKFYLYLLSGIVVMGIFTCIVYNLKQTGVLLRFFSMLSFSFF
LGGLHVYFIRYFFDKFEIENKFKELLVAVVTGLVMVVPIIMIASYFQDLKYLGYYFLIITTFVVPSAFYA
LFNYSISVPVKLYSKWYYPLGNKYESPKHYELNNMIVLNFMFYKNTKETHLTSFKAKAPKDMDFGRLFFF
FINDYNSKKTTTKIELLEDSGDPFGWYFQTKPKWFGASKHINSSLTVEQNNLNDGDTVVCQRI
 
Nucleotide Sequence: 822 bp     [Download]
>gi|319951593|ref|NC_014934.1|:c4288070-4287249 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGCCTTTTATGATTATTGTGGTCATCACAGTACTCATACTTACCTTATTTGCTTCAAAAACACCTGGAT
TTAAAAAACAACGGAAGAAGTTTTACCTCTATTTGTTATCAGGGATTGTCGTTATGGGTATTTTCACCTG
TATTGTTTATAACTTAAAACAAACAGGGGTATTATTGCGATTTTTCTCCATGCTTAGTTTCTCTTTCTTT
CTAGGAGGCTTACATGTCTATTTTATTCGTTATTTCTTTGATAAATTTGAAATTGAAAACAAATTTAAAG
AATTACTCGTTGCAGTTGTTACAGGCTTGGTCATGGTCGTACCTATTATTATGATTGCTTCTTATTTTCA
GGATCTAAAATATTTAGGGTATTATTTTTTAATCATAACAACTTTTGTAGTTCCTTCTGCTTTTTATGCG
TTGTTTAACTACTCCATTAGCGTTCCTGTAAAACTGTACTCTAAATGGTATTATCCATTAGGAAATAAAT
ATGAATCGCCTAAACATTACGAGTTAAACAATATGATTGTTTTAAACTTTATGTTTTATAAAAATACCAA
GGAAACACACTTAACAAGTTTTAAAGCTAAAGCTCCAAAAGATATGGATTTTGGGAGGTTATTTTTCTTC
TTTATTAATGATTACAACAGTAAAAAAACAACTACTAAAATAGAACTTTTAGAAGATTCTGGTGATCCAT
TTGGATGGTATTTTCAGACAAAACCTAAATGGTTTGGAGCATCAAAACATATAAATTCATCACTAACCGT
AGAACAAAACAATCTAAATGATGGCGACACCGTAGTGTGCCAACGTATATAA