SecReT6
Protein ID: 319955226
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3746
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4288121..4289029 [-]
Producthypothetical protein
NoteTssG
UniProt IDE6XAN3
KEGG IDcao:Celal_3746
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 302 a.a.     [Download]
>gi|319955226|ref|YP_004166493.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MEKNILKEVQDHFNDLNFDIKAETFAAGITEFSEVTYSYSDYFQRRYSPDVSGIREDDVYKENVVVHLSR
RGFYNIFPERFFHKTVGSTGFVNEMVNAYKNRKVEQEKAQSFFSPLEEEFFLHRVEVEREEDRIFESLGN
SELVYFLSDLWEINANIPHEMAGKILKSIPFMHKIAGNLTLIQQVLETITQENLTITKTYTTIPNTHEHN
DTLQLGVNLATATSGASYLPKYTFTINNIKKPENIYDYLPQGKIILVMNYFLDHTMPFESDFEIDFTLPQ
KKQNFTLSDSIFAGRLGISSTI
 
Nucleotide Sequence: 909 bp     [Download]
>gi|319951593|ref|NC_014934.1|:c4289029-4288121 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGGAAAAAAATATACTAAAAGAAGTTCAAGATCATTTTAATGATTTAAACTTTGACATTAAAGCGGAAA
CTTTTGCGGCAGGCATTACAGAATTTTCAGAAGTTACCTATAGCTATTCCGACTATTTTCAAAGGAGATA
TAGTCCAGATGTTTCTGGCATCAGAGAAGACGATGTTTATAAGGAGAATGTAGTTGTTCACCTAAGTCGT
CGTGGCTTTTATAATATTTTTCCGGAGCGTTTTTTCCATAAAACCGTTGGTAGTACTGGGTTTGTGAATG
AAATGGTGAATGCCTATAAAAACAGAAAAGTAGAACAAGAAAAGGCACAATCCTTTTTTAGTCCGCTAGA
GGAAGAATTTTTTCTACACAGAGTAGAAGTAGAACGAGAAGAAGATCGTATTTTTGAATCGTTAGGAAAT
TCTGAGTTAGTTTATTTCTTGTCAGACTTATGGGAAATAAATGCTAATATTCCGCATGAGATGGCAGGAA
AAATTTTAAAATCAATTCCTTTCATGCATAAGATTGCAGGAAATTTAACGTTAATACAGCAAGTACTAGA
AACCATTACACAAGAGAATTTAACCATAACTAAAACATATACCACCATCCCGAACACTCATGAACATAAT
GACACCCTACAATTAGGTGTAAATTTGGCCACTGCAACTAGTGGTGCGTCTTATTTACCTAAGTATACTT
TTACGATTAATAATATTAAAAAACCCGAAAATATATATGACTATTTACCACAAGGAAAAATTATTTTAGT
AATGAATTATTTTTTAGATCACACCATGCCTTTTGAAAGTGATTTTGAAATTGATTTTACTTTGCCTCAG
AAAAAACAAAATTTTACACTGAGTGATTCCATCTTTGCGGGACGTCTCGGAATATCTTCTACAATATAA