SecReT6
Protein ID: 319955228
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3748
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4289722..4290747 [+]
Productpkd domain containing protein
NoteTssP
UniProt IDE6XAN5
KEGG IDcao:Celal_3748
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 4.90E-15, Aligned region: 63..102
PKD [PF00801], Evalue: 4.90E-15, Aligned region: 134..186
Protein Sequence: 341 a.a.     [Download]
>gi|319955228|ref|YP_004166495.1| pkd domain containing protein [Cellulophaga algicola DSM 14237]
MKSNNIKTHFDRNVFLTFLVLFLVGLIMVSFKINSKVDCGNPDFKIISNSFTTEDLIEFNSIDDSGVEWE
WDFGDKTSTKYQSNVAHQFKIPGTYKIALKVNGQCNVVKEIKISKKKELISPELIPNINLPINVKVGEEV
VFSSDATFAESWQWSFGESLYIDGTDKEVKYTFKSPGEKTILLVVNGDRLHESRRKITVLDKRGQRTVIK
SHIKEDPIQKTIDALIPDSLKTNSKITVPAVEAPPAVKKINVSSDEILQMLVGYSERRIDDRAIREYFTY
NSIPVFNESGKRREVSELFKFIRDQKMDVKSLKLKKDQKTGKINSMTIEMKIKKGLFSKNF
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4289722-4290747 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGAAAAGTAATAATATAAAAACCCACTTTGACCGAAACGTATTTCTAACTTTTTTAGTATTATTTCTTG
TAGGATTAATAATGGTATCTTTTAAAATCAACAGTAAAGTAGACTGTGGGAATCCAGATTTTAAGATTAT
ATCTAACTCATTTACTACAGAAGATTTGATTGAATTTAATAGCATTGACGATTCTGGTGTTGAATGGGAG
TGGGATTTTGGCGACAAAACTAGTACTAAATATCAATCTAATGTTGCACATCAATTTAAAATTCCAGGTA
CTTATAAAATTGCACTTAAAGTAAATGGCCAATGTAATGTGGTTAAGGAAATTAAAATCTCCAAGAAAAA
AGAATTAATTTCTCCGGAATTAATTCCGAATATAAATTTACCTATCAATGTAAAAGTAGGTGAGGAGGTT
GTTTTTTCAAGTGATGCAACATTTGCAGAATCATGGCAATGGAGTTTTGGAGAATCGTTATATATTGATG
GAACAGATAAAGAAGTTAAATATACTTTTAAATCTCCGGGAGAAAAAACAATTTTATTGGTCGTAAATGG
AGATAGGTTACATGAATCTAGAAGAAAAATAACGGTTTTAGATAAAAGAGGGCAGCGTACTGTTATAAAG
TCGCATATAAAGGAAGATCCTATACAAAAAACTATAGATGCTCTTATTCCAGATTCATTAAAAACAAATT
CAAAAATTACAGTACCAGCCGTAGAAGCTCCTCCTGCAGTTAAAAAAATAAATGTTTCTTCAGATGAAAT
TCTACAAATGTTAGTTGGGTATTCTGAACGAAGAATTGATGATAGAGCAATTCGTGAATATTTTACGTAC
AACAGTATTCCGGTTTTTAACGAATCAGGAAAAAGACGCGAAGTTAGTGAGCTATTTAAATTTATTAGAG
ATCAGAAAATGGATGTTAAATCTTTGAAACTTAAAAAAGATCAGAAAACTGGAAAAATAAACAGTATGAC
TATTGAAATGAAAATTAAAAAAGGACTGTTTTCTAAGAATTTTTAA