SecReT6
Protein ID: 319955229
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3749
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4290904..4291290 [+]
Producthypothetical protein
NoteHcp
UniProt IDE6XAN6
KEGG IDcao:Celal_3749
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|319955229|ref|YP_004166496.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MAFKARLKVAGKEFNILHCSYDLNQEVDPTGRPSSVTRGGRINLTVESNGETGFFEWMTNNFERKDGTIV
FVKRDNDATLKEVNFKEGYLIKYRENFESSGQNPLTETFTISAKELSAGGGEHINEWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4290904-4291290 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGGCTTTCAAAGCAAGATTAAAAGTAGCAGGAAAAGAATTTAACATCTTACATTGTTCTTACGATTTAA
ATCAAGAAGTAGATCCAACAGGAAGACCTTCTTCTGTAACAAGAGGTGGTCGTATCAACTTAACAGTTGA
GTCTAACGGAGAAACAGGTTTTTTCGAATGGATGACAAATAATTTCGAGAGAAAAGATGGAACTATTGTT
TTCGTAAAAAGAGACAATGATGCTACCTTAAAAGAAGTAAACTTCAAAGAAGGTTACTTAATCAAGTACA
GAGAGAACTTCGAGTCTTCTGGTCAAAATCCTTTAACAGAAACTTTTACTATTTCTGCAAAAGAATTATC
AGCTGGTGGCGGTGAGCACATCAACGAGTGGGTATAA