SecReT6
Protein ID: 319955230
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3750
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4291419..4291868 [+]
Producthypothetical protein
NoteTssB
UniProt IDE6XAN7
KEGG IDcao:Celal_3750
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|319955230|ref|YP_004166497.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MASNFGIGANDVKGDASEALNEIPQNRTLIAGKLTPNTPIKPEVIEGLRTVEDIFEHFRPELKVPFEDKN
GGTINETIKFKNLGDFGKKGITNNSVFLKELEIESDQYKKIIKQLKTNKILKSALQDPEAKGALIDTIDA
LINEIKNTK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4291419-4291868 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGGCTAGTAATTTTGGAATAGGTGCTAATGATGTTAAAGGCGATGCAAGTGAAGCTCTAAATGAAATTC
CACAAAACAGAACTTTAATTGCAGGTAAATTAACTCCGAACACACCAATTAAGCCAGAAGTAATAGAAGG
TTTGAGAACTGTAGAAGATATTTTTGAACATTTTAGACCAGAATTAAAAGTTCCTTTTGAAGATAAAAAT
GGTGGAACGATTAACGAGACTATAAAATTCAAAAATTTAGGCGATTTCGGAAAAAAAGGAATTACCAATA
ATAGTGTTTTCTTAAAAGAATTAGAAATTGAAAGTGATCAATATAAAAAAATCATTAAGCAATTAAAGAC
TAATAAAATTCTAAAATCTGCATTACAAGATCCTGAAGCTAAAGGAGCGTTAATAGATACTATTGATGCA
TTGATTAATGAAATTAAAAACACTAAATAA