SecReT6
Protein ID: 319955231
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3751
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4291884..4293242 [+]
Producthypothetical protein
NoteTssC
UniProt IDE6XAN8
KEGG IDcao:Celal_3751
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-13, Aligned region: 107..396
Phage_sheath_1 [PF04984], Evalue: 0.00019, Aligned region: 290..432
Protein Sequence: 452 a.a.     [Download]
>gi|319955231|ref|YP_004166498.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MANTSQNNQESHLSDKPFIDQIKEKSDGLAKFGGFDLLESAIDDVQNLNPERKARRKMFLTENGKKTERL
ALQKILELWSETLKSGDDILDQVQSADDKSKQSLELLNKNIKQALHESEELESSYRSVALFYKNTDLPSL
KNVSIVNAELDQLTDLDNTRFFDHIREELVSKYDRLDLRENYSLMVLPGYLGSKSVVDKWAKLAHENKVT
LVTDFAHLDEPDDVMEMFESANLASGDMYLSNTIMTCNWLVGRGKHAEVGEEEDLHVAPSGALAGKIYRT
LMSQVTAGKKHGGLSEVDGVAFDLRKGEIANLENLGLVPMVNEYGKVMAFSAKTLFNGDNLGLQTYSVVR
VFDYVTKVLMDFLNRRAFENFNAKTRNEIHKQIVQFLDGITGPDKLIENFEIKKFEQDPNQLDRILLDVR
LKPYFPAKNFLIKMDGQKGDEGSEWDTDYEQQ
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4291884-4293242 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGGCGAATACTTCACAAAACAATCAAGAGTCACACTTAAGTGATAAACCTTTTATAGATCAAATTAAAG
AAAAATCAGACGGGTTAGCCAAGTTTGGTGGATTTGATTTATTAGAATCAGCTATAGATGATGTACAGAA
TCTAAACCCTGAACGTAAGGCTAGAAGAAAAATGTTCTTAACAGAAAATGGGAAGAAAACAGAGCGATTA
GCATTACAAAAAATTCTTGAGCTTTGGTCTGAAACATTAAAATCTGGTGATGATATCTTAGATCAAGTAC
AATCTGCAGATGATAAGTCTAAACAATCTTTAGAACTTTTAAATAAAAATATTAAACAAGCACTTCATGA
GTCTGAAGAATTAGAATCTTCTTACCGTTCAGTAGCGCTTTTCTATAAAAATACAGACTTACCTTCGTTA
AAAAATGTCTCTATAGTTAATGCAGAATTAGATCAGTTAACAGATTTAGACAACACGCGTTTCTTTGATC
ATATTAGAGAAGAATTAGTTTCTAAATACGATAGATTAGATTTAAGAGAAAATTATTCTTTAATGGTGCT
TCCAGGGTATTTAGGGTCAAAATCTGTAGTTGATAAATGGGCAAAATTAGCACATGAAAACAAAGTTACC
TTGGTAACAGATTTTGCACATTTAGATGAGCCAGATGATGTTATGGAAATGTTTGAAAGTGCCAACCTAG
CTAGTGGTGATATGTATTTGTCTAATACAATAATGACTTGTAATTGGTTAGTAGGTAGAGGTAAACATGC
TGAAGTAGGAGAGGAAGAAGATCTACACGTAGCCCCTTCAGGAGCATTAGCCGGTAAAATATACAGAACA
TTAATGTCTCAAGTAACCGCTGGTAAAAAACACGGTGGACTTAGCGAGGTAGATGGGGTAGCTTTTGATC
TTAGGAAAGGTGAAATTGCCAATTTAGAAAACCTTGGACTTGTTCCTATGGTAAATGAATATGGTAAAGT
AATGGCTTTCTCTGCTAAGACATTATTTAATGGTGATAACTTAGGATTACAAACTTATTCTGTAGTACGT
GTTTTTGATTATGTAACAAAAGTATTGATGGATTTTCTTAACCGTAGAGCTTTTGAAAATTTCAATGCTA
AAACTAGAAATGAAATTCACAAACAAATAGTACAATTCTTAGACGGAATTACGGGTCCTGATAAATTGAT
CGAGAATTTTGAAATTAAAAAATTCGAACAAGATCCAAATCAATTAGACCGTATATTACTAGATGTACGT
CTTAAGCCTTATTTTCCTGCTAAAAACTTTTTGATTAAAATGGATGGTCAAAAAGGAGATGAAGGATCTG
AATGGGATACAGATTACGAACAACAATAA