SecReT6
Protein ID: 319955232
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3752
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4293401..4293790 [+]
Producthypothetical protein
NoteHcp
UniProt IDE6XAN9
KEGG IDcao:Celal_3752
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|319955232|ref|YP_004166499.1| hypothetical protein [Cellulophaga algicola DSM 14237]
MSFLAKLIVDGQEYNVLHCNYNFEQPMDHTGKPSGKPRGGQIMITIESQGKSDLFHWMMEPEQTKDGAII
FYKRDALSRLQEVTFTQAFCVSLEEEFDAIDDVPMQKTIVISATTITIGDMTFENSWGE
 
Nucleotide Sequence: 390 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4293401-4293790 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGTCTTTTTTAGCAAAATTAATTGTAGATGGTCAAGAATACAATGTATTACATTGTAACTATAATTTTG
AACAACCCATGGATCATACCGGTAAACCTTCGGGAAAACCAAGAGGTGGTCAAATAATGATTACTATAGA
ATCTCAAGGAAAATCTGATCTTTTTCATTGGATGATGGAACCAGAACAAACCAAAGATGGGGCTATCATA
TTTTATAAGCGCGATGCATTATCACGTTTACAAGAAGTAACCTTTACCCAAGCATTTTGTGTAAGTCTTG
AGGAAGAATTTGACGCTATAGATGATGTGCCTATGCAGAAAACGATTGTAATCTCTGCTACTACCATTAC
AATTGGTGACATGACATTTGAAAATAGTTGGGGAGAGTAA