SecReT6
Protein ID: 319955239
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3759
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4300150..4302813 [+]
Productpkd domain containing protein
NoteTssP
UniProt IDE6XAP6
KEGG IDcao:Celal_3759
PDB IDNA
Domain hit(s) vs Pfam Xylanase [PF13201], Evalue: 3.40E-29, Aligned region: 263..331
Xylanase [PF13201], Evalue: 3.40E-29, Aligned region: 346..410
Xylanase [PF13201], Evalue: 3.40E-29, Aligned region: 432..502
Xylanase [PF13201], Evalue: 3.40E-29, Aligned region: 516..580
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 94..123
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 114..146
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 277..328
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 349..408
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 409..409
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 556..567
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 630..651
PKD [PF00801], Evalue: 1.40E-09, Aligned region: 703..759
DUF3872 [PF12988], Evalue: 1.00E-07, Aligned region: 8..132
DUF3872 [PF12988], Evalue: 1.00E-07, Aligned region: 150..241
Protein Sequence: 887 a.a.     [Download]
>gi|319955239|ref|YP_004166506.1| pkd domain containing protein [Cellulophaga algicola DSM 14237]
MKITTKYILGLIAILAVIIACTKEVGLYTEVEFEISETHVANGFINTPLATSITVTPEELVEGYSYSFSY
KINTGEGYFQDETGNTIPEGDKIGLNPLSATLNYIATKIGDHSITFTAEDTFGFQEQVTASYTISDVPVS
WTATGPTGQVLLGTSQDISVTLGNETTATGVTYERNYSFTEGTGTITSSPRGTSETLNEFVSITPGAYAL
EYVSTELGQTTLEFLLKDSNGQEIVQTVSFEVVDELSTEKEITSFIVNGVVGTISGTTIDVVLPEGTDVT
ALAPVITHTGASISPESETSQDFSNPVIYTVAAQDQTIQEYTVTLTVEGNEAKDITDFAIDGVDGIITGT
NISVTLPAGTDVTSLSSTVTHTGASVNPTSGVAQDFTSPVEYTVTAADGTTKVYTVTVSLAPALSSDNNI
TSFSIDGVAGVISGTTITVTLPAGTDVSSLTPAIIHTGNTVNPDTGIAQDFTNPITYTVTAANLDTQEYS
VTVIMPTLSDTKDITSFSIDGVAGVISGTTITVTLPAGTDVSSLTPAINDNGNTVNPNTGVAQDFTNPVE
YTVTAADTTTKTYTVTAIISAAVNIDPVAIDDNFTVIENSPNNTLDVLDNDSDPDGTVLTIVALETPING
SATIAPGGQSILYTATTGNDRFDYTIEDEDGATTMGTIDVNVVPNENPTVEIDDLILIPNGNFPKTISFA
VANSNDTDGTIENYEWNFGDPSSTGNIINNTDSNATSHTFNSAGTYNIVLTVTDNLGATGSDTVRITLEE
PLAPDFTFTANTYQPQPIDGHTKGGPIELYFSINPNAALDGGNYIMTMETGKATLKINGSTYREVINIPM
TTTPVIGPFTDLLFNNEVTVTFRVIEMISGIEKTRTLFFTYCDGLCP
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4300150-4302813 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGAAAATCACAACTAAATATATATTAGGTTTAATTGCTATTTTAGCAGTCATCATTGCGTGTACCAAAG
AAGTGGGACTATACACTGAAGTAGAATTTGAAATTTCAGAAACTCATGTGGCAAATGGTTTTATCAATAC
ACCGCTAGCGACTTCTATTACCGTTACACCAGAAGAACTAGTGGAAGGATATTCGTATTCCTTTTCGTAT
AAGATTAATACAGGCGAGGGATATTTTCAAGATGAAACGGGAAATACTATTCCCGAAGGAGATAAGATTG
GTTTGAATCCATTATCAGCGACATTAAATTATATTGCTACAAAAATAGGAGATCACTCCATCACTTTTAC
CGCAGAAGATACTTTTGGTTTTCAGGAGCAGGTTACTGCATCTTACACTATCAGTGATGTTCCTGTTTCT
TGGACTGCTACAGGACCTACGGGACAAGTTTTATTAGGTACATCACAAGATATCTCTGTTACTTTAGGGA
ATGAAACTACTGCAACAGGAGTTACGTATGAACGGAATTATTCCTTTACAGAAGGAACAGGTACAATAAC
TTCTTCTCCAAGAGGAACAAGCGAAACTTTAAATGAATTTGTTAGTATTACACCAGGGGCATATGCTTTA
GAATATGTATCTACCGAATTAGGGCAGACCACGCTAGAGTTTTTATTGAAAGATTCAAACGGACAAGAAA
TAGTCCAAACCGTAAGTTTTGAAGTTGTAGATGAACTTTCTACAGAAAAAGAAATTACTTCCTTTATAGT
AAACGGAGTAGTAGGTACTATTAGTGGAACTACCATCGATGTTGTTCTTCCAGAAGGAACAGATGTAACA
GCCTTAGCACCAGTAATTACACACACAGGAGCAAGTATTTCGCCAGAATCAGAAACAAGTCAAGATTTTT
CGAATCCTGTAATCTATACCGTTGCTGCTCAAGATCAAACGATACAAGAATATACCGTTACTTTAACTGT
CGAAGGAAATGAAGCCAAAGATATCACTGATTTTGCAATTGATGGTGTTGATGGAATTATTACAGGAACC
AATATTTCCGTAACCTTACCAGCAGGAACAGATGTTACCTCATTAAGTTCTACGGTAACTCATACTGGTG
CTTCTGTAAACCCTACTTCTGGAGTAGCGCAAGACTTTACAAGCCCTGTGGAGTATACCGTTACCGCAGC
AGATGGAACTACTAAAGTGTATACTGTTACGGTGAGTTTAGCCCCAGCTCTTAGTAGTGATAATAACATT
ACATCATTTAGTATTGATGGAGTTGCTGGCGTCATTTCAGGAACAACAATTACCGTAACACTTCCTGCAG
GAACAGATGTAAGTAGTCTAACGCCTGCTATAATTCATACTGGTAATACGGTAAATCCAGATACTGGAAT
AGCTCAAGATTTTACAAACCCGATTACTTATACGGTGACAGCTGCTAACTTAGATACTCAAGAATACTCG
GTAACGGTTATTATGCCTACCCTTAGTGATACGAAGGATATTACATCATTTAGTATTGATGGAGTTGCTG
GTGTTATTTCCGGAACAACAATTACGGTGACACTTCCTGCAGGAACAGATGTAAGCAGTTTAACGCCTGC
TATAAATGATAATGGAAATACAGTAAATCCAAATACAGGAGTAGCTCAAGATTTTACAAATCCTGTAGAA
TACACTGTTACCGCAGCAGATACTACGACTAAAACATATACTGTTACGGCTATTATTTCAGCTGCTGTTA
ACATAGATCCTGTAGCTATTGATGACAACTTTACAGTAATAGAAAATTCTCCAAATAACACATTAGATGT
TCTTGATAATGATAGTGATCCTGATGGAACTGTTTTAACTATTGTAGCTCTAGAAACACCTATAAATGGT
AGCGCAACGATTGCACCTGGAGGACAATCAATATTATATACGGCTACCACAGGAAATGATAGATTTGACT
ATACCATTGAAGATGAAGATGGAGCTACTACTATGGGTACCATTGATGTTAATGTAGTTCCAAATGAAAA
TCCTACAGTAGAAATTGACGATTTAATTTTAATACCTAATGGGAATTTTCCTAAAACGATAAGTTTTGCG
GTGGCTAATTCAAATGACACTGATGGAACCATTGAAAATTATGAATGGAATTTTGGTGATCCTAGTTCTA
CAGGAAATATAATAAACAATACAGATTCAAACGCTACCTCACATACTTTCAATAGTGCTGGCACCTATAA
TATCGTTTTAACAGTCACTGATAATCTCGGAGCTACAGGGTCTGATACTGTTCGAATTACTCTAGAAGAA
CCATTAGCGCCAGATTTTACTTTTACAGCTAACACTTACCAACCACAACCTATAGATGGTCATACAAAAG
GAGGTCCAATTGAATTATATTTTAGTATAAATCCTAATGCTGCTTTAGATGGAGGAAATTATATTATGAC
CATGGAAACAGGAAAAGCAACCTTAAAGATAAATGGATCAACCTATAGAGAAGTTATTAATATTCCTATG
ACTACGACTCCTGTTATAGGACCCTTTACAGATTTATTATTTAACAATGAAGTTACTGTTACATTTAGGG
TTATTGAAATGATTAGCGGAATTGAAAAAACTAGAACTTTATTTTTCACCTATTGTGATGGTTTGTGTCC
ATAA