SecReT6
Protein ID: 319955240
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3760
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4302889..4305825 [+]
Productpkd domain containing protein
NoteTssP
UniProt IDE6XAP7
KEGG IDcao:Celal_3760
PDB IDNA
Domain hit(s) vs Pfam Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 264..330
Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 347..413
Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 418..494
Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 500..580
Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 584..666
Xylanase [PF13201], Evalue: 3.10E-39, Aligned region: 671..762
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 93..123
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 155..215
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 311..328
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 519..579
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 613..669
PKD [PF00801], Evalue: 1.40E-08, Aligned region: 781..844
DUF3872 [PF12988], Evalue: 4.20E-06, Aligned region: 12..132
DUF3872 [PF12988], Evalue: 4.20E-06, Aligned region: 150..241
Protein Sequence: 978 a.a.     [Download]
>gi|319955240|ref|YP_004166507.1| pkd domain containing protein [Cellulophaga algicola DSM 14237]
MKKTYKYTFGFLAILALIIACTKDVGLYTEVEFEISETHVADGFINTPLATSITVTPEELVEGYSYSYSY
KINTGEGYFQDESGATIAQGDKIGLNPLSASLNYIATKIGDHSITFTAEDTFGFQEQVTASYVISDVPVS
WTATGPTGQVLLGSSQDITVTLGSETTGAGVTYERNYSFTQGTGTITSSPSGTSEILNEFVSITPGTYAL
TYVATELGQTTLEFLLKDSNGQEIVQTISFEVVNELSTVKEITSFIVNGVEGTIVGTDITIELPEGTDLT
TLSPVIIHTGASISPESETSQDFTNPVSYTVTAQDQTIQEYTVTLTVEGNEAKDITDFAIDGVDGIITGT
NISVTLPAGTDVTALSPTIVHEGISINPASGVAKDFTSPVEYTVTAADGTTQVYTVTVSLAPTLSSDKDI
TTFTIDGVVVNNPVTAFTITLPAGTDVTTLSPTIMHEGSSINPDSGVIQNFTSPVEYTVTAADGTTQVYT
VTVSLALALSDEKNITTFTIDGEVVNNPVSAFTITLPAGTDVTALSPTLTHTGASVNPASAVAQNFTSPV
EYTVTAADGTTKTYTVTVSLAPALSSDKDITSFTMDGETVNDPATAFTITLPAGTDVTALSPNIVHEGNT
IDPASGVAQDFSSSVGYTVTAADGSTQVYTVTVNLAAPVNEAPIAQADIFTVIENSSNNTLDVLNNDSDA
DGTVLTIIAVDTPINGSATIAPGGQSILYNATTGNDRFDYTIEDEDGATTMATIDINVVPNQNPTVEITD
RILIPTTDYPRTVTFNVASSNDTDGTIENYEWNFGDIGSTGNIINNTSPTATSHTFDDPGPYDVVLTVTD
DLGGTGFDTVEIVLEPVQEPGYTFSIDPIPDPVTTFTQDITFRIIPNAAAIAQGIEFTMRYEDRSGLANI
TFIEYDNQDHIVGSSFIVNSGTTSGILQGPFTECNDIEFEFIVSTNLVLPDQTKTVSFLINTGFAACP
 
Nucleotide Sequence: 2937 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4302889-4305825 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGAAAAAAACCTACAAATATACATTCGGATTTTTAGCAATACTAGCTTTAATCATAGCCTGTACCAAAG
ACGTTGGACTTTATACTGAAGTGGAATTTGAAATTTCAGAAACTCATGTGGCAGATGGCTTTATTAATAC
ACCGCTAGCTACTTCTATTACGGTTACGCCAGAGGAACTCGTGGAAGGGTATTCTTATTCCTATTCTTAT
AAAATTAATACAGGTGAAGGGTATTTTCAAGATGAATCCGGGGCTACTATTGCACAAGGAGATAAAATAG
GTTTGAATCCATTATCAGCCTCACTAAATTATATTGCCACAAAAATAGGCGATCACTCAATTACTTTTAC
CGCTGAAGATACTTTTGGCTTTCAGGAGCAGGTTACTGCATCTTATGTTATTAGTGATGTTCCTGTTTCT
TGGACGGCCACAGGACCCACAGGCCAAGTACTTTTAGGTAGCTCACAAGATATTACGGTTACTTTAGGAA
GTGAAACTACAGGCGCAGGAGTTACGTATGAACGAAATTATTCTTTTACTCAAGGAACAGGTACAATAAC
ATCTTCTCCTAGTGGAACGAGTGAAATTTTGAATGAATTTGTTAGTATTACACCTGGAACGTATGCCTTA
ACCTATGTAGCTACAGAATTAGGACAAACAACTTTAGAGTTTTTATTGAAAGATTCAAACGGACAAGAAA
TAGTTCAAACCATAAGTTTTGAAGTGGTTAATGAGCTTTCTACCGTAAAAGAAATTACTTCATTTATAGT
AAATGGAGTAGAAGGTACCATAGTTGGAACGGATATTACTATAGAACTTCCTGAAGGAACTGACTTAACT
ACATTGTCACCAGTTATTATTCATACAGGAGCAAGTATCTCACCAGAATCAGAAACAAGTCAAGACTTTA
CGAATCCAGTAAGTTATACTGTTACGGCTCAAGATCAAACGATACAAGAATATACTGTTACGTTAACTGT
CGAAGGAAATGAAGCCAAAGATATCACTGATTTTGCAATTGATGGAGTTGATGGAATTATTACAGGAACC
AATATTTCCGTAACCTTACCAGCAGGAACAGATGTTACCGCATTAAGTCCCACTATAGTGCATGAAGGGA
TCTCAATCAATCCTGCATCAGGTGTAGCCAAAGATTTTACAAGTCCTGTTGAGTATACGGTTACCGCTGC
TGATGGAACTACTCAAGTGTATACCGTTACAGTAAGTTTAGCTCCAACTCTTAGTAGTGATAAAGATATC
ACCACATTTACTATTGACGGAGTAGTGGTGAACAATCCTGTAACAGCATTTACAATTACCCTCCCTGCAG
GAACAGATGTTACCACATTAAGTCCTACTATAATGCATGAAGGAAGCTCAATCAATCCCGATTCGGGAGT
AATCCAAAATTTTACAAGTCCTGTTGAGTATACGGTTACTGCTGCTGATGGCACTACACAAGTGTATACA
GTTACAGTCAGTTTAGCCCTAGCCCTTAGTGATGAGAAAAACATTACTACTTTTACAATTGATGGAGAAG
TCGTGAATAATCCTGTATCAGCATTTACGATTACGCTTCCCGCAGGAACGGATGTTACAGCATTAAGCCC
TACTTTAACCCATACTGGTGCTTCTGTAAATCCTGCTTCGGCTGTAGCACAAAACTTTACAAGTCCTGTA
GAATATACTGTTACCGCAGCAGATGGGACTACTAAAACGTATACCGTTACGGTGAGTTTAGCACCAGCTC
TTAGCAGTGATAAAGACATTACCTCATTTACTATGGATGGAGAAACGGTGAACGATCCTGCAACAGCATT
TACCATTACACTTCCTGCAGGAACAGATGTTACCGCATTAAGTCCTAATATAGTGCATGAAGGGAACACA
ATCGATCCTGCTTCTGGAGTAGCACAAGACTTTTCTAGTTCTGTGGGTTATACGGTTACTGCTGCTGATG
GAAGTACTCAAGTCTATACGGTTACGGTGAATTTAGCAGCTCCTGTTAACGAAGCGCCAATAGCCCAGGC
GGATATATTTACAGTAATTGAAAATTCCTCAAATAATACATTAGATGTTCTTAATAATGATAGTGATGCT
GATGGAACCGTTTTAACTATTATAGCGGTAGATACACCTATAAATGGTAGCGCAACAATTGCTCCTGGAG
GGCAATCTATACTTTATAACGCGACTACTGGGAATGATAGATTTGACTATACGATTGAAGATGAAGATGG
AGCTACTACAATGGCTACCATAGATATTAATGTAGTGCCAAATCAAAACCCTACTGTAGAAATAACAGAT
AGAATTTTGATTCCAACAACAGATTACCCTAGAACGGTAACTTTTAATGTAGCAAGTTCTAATGATACTG
ACGGAACCATTGAAAATTATGAATGGAATTTTGGTGATATTGGATCGACAGGAAATATAATAAATAATAC
AAGTCCAACTGCTACATCACATACTTTTGATGATCCAGGGCCATATGATGTTGTATTAACTGTTACAGAT
GACCTAGGAGGTACTGGATTTGATACCGTAGAAATAGTTTTGGAACCGGTTCAAGAGCCTGGCTATACAT
TTAGTATTGACCCAATTCCTGATCCAGTAACGACTTTTACGCAAGATATAACTTTTAGAATAATACCAAA
TGCCGCGGCAATAGCACAGGGAATAGAATTTACTATGCGTTATGAAGATAGATCTGGTCTCGCTAATATT
ACTTTTATTGAGTATGATAATCAAGATCATATTGTCGGCAGTAGTTTTATTGTTAATTCGGGAACTACAT
CTGGTATACTTCAGGGACCTTTTACTGAATGTAACGATATAGAATTTGAATTTATAGTCTCTACAAACCT
TGTATTACCAGATCAAACGAAAACAGTTAGTTTTTTAATTAATACTGGATTTGCAGCTTGTCCATAA