SecReT6
Protein ID: 319955242
SecReT6 ID915
T6SS typeiii
Gene symbol-
Locus tagCelal_3762
StrainCellulophaga algicola DSM 14237
Repliconchromosome [GenBank: NC_014934] [Browse all T6SS(s) in this replicon]
Location [Strand]4310578..4313256 [+]
Productpkd domain containing protein
NoteTssP
UniProt IDE6XAP9
KEGG IDcao:Celal_3762
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 8.80E-56, Aligned region: 101..125
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 112..124
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 320..328
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 345..404
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 436..495
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 530..588
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 691..691
PKD [PF00801], Evalue: 8.80E-56, Aligned region: 706..773
Xylanase [PF13201], Evalue: 2.80E-08, Aligned region: 263..328
Xylanase [PF13201], Evalue: 2.80E-08, Aligned region: 458..489
REJ [PF02010], Evalue: 1.70E-05, Aligned region: 311..379
REJ [PF02010], Evalue: 1.70E-05, Aligned region: 389..564
REJ [PF02010], Evalue: 1.70E-05, Aligned region: 479..605
REJ [PF02010], Evalue: 1.70E-05, Aligned region: 708..770
DUF3872 [PF12988], Evalue: 0.00013, Aligned region: 8..132
DUF3872 [PF12988], Evalue: 0.00013, Aligned region: 153..242
Protein Sequence: 892 a.a.     [Download]
>gi|319955242|ref|YP_004166509.1| pkd domain containing protein [Cellulophaga algicola DSM 14237]
MKNFKTLGISLILILTIIIACTKEVGLYTEVEFEITEEHEVDGFINNPLATFLIVTPEELLEDLSYSFSY
KINSGAGYFEAVDGTIIQEGEKASFNPLSASLDYIPTSIGDHSVTFTASDTFGFTEEITLTYTITNIPVT
WTAEGPTGPVLLGSSQSITLTLGNEAAITGATYQRNYSFSEGSGNLYTAAPESNTIAVNDFVSIVPGTYQ
LEYISNELGITTIEFLLRDSNEQELIATVTFEVVDELSTEKEITSFIVNGIAGTITGTTIDVVLPEGTDL
TALAPVIIHTGASISPESEINQDFSNPVIYTVTAQDETIQAYTVNVTVPSANQAPTAIATSDVTSGVPSL
DVQFTGDTSTDPDAGDVLTYAWNFGDGSTATTANPSHTFTTAGTYTVTLTVTDDRTPALNSTDTITIIVT
DANQAPTAIATSDVTSGEVSLDVQFTGDTSTDPDTGDTLTYAWNFGDGTTATTANPSHTFTTAGTYTVTL
TVTDDGTPALSSSEVTITITVNAPANQTPTAIATSDVTSGVPSLDVQFTGDTSSDPDTGDTLTYAWNFGD
GTTATTANPSHTFTTVGTYTVTLTVTDNGTPALSSSEVTITITVNAPANQAPTAVADNYSVIKGTNNNLF
NVIANDSDPDGDTLTVTLELFPLNGTATMSGNQVSYSPNINFVGTDQIGYQISDGNGGMASGSITVTVTG
PTNQAPTAVATGPTATITGVVENFYADSSSDPDGDNLTYLWDFGDTTTSNLINPTHSYTTVGTYTVTLTV
TDNGSPVLSDSEVILINVTGATPTATFSNSQIVTDANPSTQGILTINNGNISFTINIFGGTGSGGVSLIF
TILGVDTWNVYADQGDVNNSITDLIPPGTYNYYIDIFTVAGGSDSSGSVIAN
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|319951593|ref|NC_014934.1|:4310578-4313256 Cellulophaga algicola DSM 14237 chromosome, complete genome
ATGAAAAATTTTAAAACTTTAGGGATATCTCTCATTTTAATACTGACTATAATAATAGCCTGTACCAAAG
AAGTAGGCTTATACACTGAAGTAGAATTTGAAATTACAGAGGAACATGAGGTTGATGGATTTATTAATAA
TCCATTAGCGACTTTCTTGATAGTTACTCCTGAGGAACTATTAGAAGATCTTAGTTATTCTTTTTCGTAT
AAAATAAATTCTGGAGCGGGGTATTTTGAAGCTGTTGACGGAACTATAATTCAAGAAGGAGAAAAAGCTT
CTTTTAATCCACTATCTGCTTCATTAGATTATATTCCAACTTCGATAGGAGATCATTCGGTAACTTTTAC
CGCATCAGATACTTTTGGTTTTACAGAAGAAATTACCCTTACCTATACCATTACGAATATTCCAGTTACG
TGGACAGCCGAAGGACCTACGGGGCCAGTACTACTAGGAAGTTCTCAAAGTATTACGCTGACCTTAGGAA
ATGAAGCGGCAATAACAGGAGCAACCTATCAAAGAAATTATTCGTTCTCTGAAGGCTCAGGGAATTTATA
TACCGCGGCTCCTGAAAGCAATACTATTGCGGTGAATGATTTTGTAAGCATTGTACCAGGAACCTATCAA
TTAGAATATATCTCTAATGAATTAGGCATTACCACTATTGAGTTTTTACTTAGAGATAGTAATGAACAAG
AATTAATAGCTACCGTTACTTTTGAAGTGGTTGATGAACTTTCTACTGAAAAAGAAATTACTTCATTTAT
AGTAAATGGAATAGCAGGGACTATTACAGGAACTACTATCGATGTGGTACTTCCTGAAGGAACTGATTTA
ACAGCTTTAGCACCCGTAATTATACATACAGGAGCAAGTATTTCGCCCGAATCAGAAATAAATCAAGATT
TTTCGAATCCTGTAATTTATACGGTTACCGCTCAAGATGAAACTATACAAGCTTATACGGTAAATGTAAC
AGTTCCTTCCGCGAATCAAGCTCCAACAGCAATAGCAACTTCAGATGTAACTTCTGGCGTTCCTTCCTTA
GACGTGCAATTTACAGGAGATACTTCTACTGATCCAGATGCTGGAGATGTATTAACGTATGCTTGGAATT
TTGGAGATGGAAGCACAGCAACAACTGCTAATCCTTCTCACACTTTTACAACCGCAGGAACGTACACGGT
AACACTTACTGTTACGGATGATAGAACTCCAGCTCTCAACAGTACGGATACGATCACGATAATAGTAACA
GATGCCAATCAAGCACCAACGGCAATAGCGACTTCTGATGTCACTTCTGGAGAAGTTTCTTTAGACGTAC
AATTTACAGGAGATACTTCTACTGACCCAGATACAGGAGATACATTAACCTATGCTTGGAATTTTGGAGA
TGGAACCACAGCAACAACTGCTAATCCTTCTCATACCTTTACAACCGCAGGAACGTACACGGTAACACTT
ACCGTTACCGATGATGGAACACCGGCTTTGTCTAGTTCAGAGGTTACAATAACAATAACCGTAAATGCTC
CTGCCAATCAAACACCAACCGCTATAGCCACTTCAGATGTAACTTCTGGCGTTCCTTCCTTAGACGTGCA
ATTTACAGGAGATACTTCTTCTGATCCAGACACTGGAGATACATTAACATATGCTTGGAATTTTGGAGAC
GGAACCACAGCAACAACTGCTAATCCTTCTCATACCTTTACTACAGTTGGAACGTATACTGTTACACTTA
CCGTTACCGATAATGGAACACCGGCTTTATCAAGTTCGGAGGTTACAATAACAATAACCGTAAATGCTCC
TGCCAATCAAGCACCAACAGCCGTGGCAGATAATTATTCAGTCATAAAAGGAACTAATAACAATCTATTT
AATGTTATTGCAAACGACTCTGACCCAGATGGGGATACGCTTACGGTTACTCTTGAACTCTTTCCTCTTA
ACGGTACAGCAACGATGTCAGGTAATCAGGTAAGTTATAGCCCAAATATAAATTTTGTTGGAACGGATCA
AATTGGATACCAAATAAGTGATGGTAATGGTGGAATGGCTAGCGGATCAATTACTGTAACCGTAACAGGT
CCTACTAACCAGGCACCAACAGCAGTTGCCACAGGGCCAACAGCCACAATTACAGGAGTTGTTGAAAATT
TTTATGCAGATTCATCATCAGATCCTGACGGGGACAATTTAACTTATTTGTGGGATTTTGGAGATACAAC
CACTTCAAATTTAATAAATCCAACACATAGTTATACAACGGTAGGAACCTATACGGTTACCTTAACTGTT
ACCGATAATGGTTCTCCCGTTCTTAGTGATTCTGAAGTAATTTTGATTAATGTTACGGGAGCTACACCAA
CAGCCACATTTAGTAATTCACAAATAGTCACCGATGCAAATCCATCAACACAAGGAATACTAACTATTAA
TAATGGAAATATATCTTTTACTATTAATATTTTTGGTGGCACAGGATCGGGAGGAGTTAGTTTAATATTT
ACAATTCTGGGTGTTGATACATGGAATGTATATGCTGATCAAGGAGATGTAAATAATTCAATTACAGATT
TGATACCACCAGGTACTTACAATTACTATATTGACATATTTACAGTAGCTGGAGGAAGTGATAGTTCTGG
ATCAGTAATAGCTAACTAA