SecReT6
Protein ID: 320106313
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1078
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1283739..1284455 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE8UX22
KEGG IDtsa:AciPR4_1078
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-38, Aligned region: 8..214
Protein Sequence: 238 a.a.     [Download]
>gi|320106313|ref|YP_004181903.1| DotU family type IV/VI secretion system protein [Terriglobus saanensis SP1PR4]
MNSPRAASLASAFQEVFTAIVRVRFRLQRVENASAFRDEIRQSLQHAMQQARSLGYTNEGIQVAVFATVA
FLDESVLNVQDPVFADWAGRPLQEELFGGHLAGEAFFQNLRTCLGQQDSSEVADVLEIHCLCLLIGYRGR
YALGDSGELHALLRQARERIRRIRGDAHLGLRPNSVPPALAIPTSDTWTRRLAWTVCFLSALVFILFVWY
EVELSSGLRLLQRTILTVAANLVSLERI
 
Nucleotide Sequence: 717 bp     [Download]
>gi|320105246|ref|NC_014963.1|:c1284455-1283739 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGAATTCGCCGCGCGCGGCCAGCCTAGCCTCTGCCTTCCAGGAAGTTTTCACCGCGATCGTACGCGTGC
GCTTCCGCCTGCAGCGTGTGGAGAACGCTTCGGCCTTCCGCGATGAAATTCGGCAGTCTCTACAGCATGC
CATGCAGCAAGCGCGTAGCCTCGGCTATACGAATGAAGGCATACAGGTAGCCGTATTCGCCACCGTAGCT
TTTCTGGACGAAAGTGTACTCAACGTCCAGGACCCCGTCTTCGCCGATTGGGCGGGACGCCCACTTCAGG
AAGAACTTTTCGGTGGCCATCTCGCTGGCGAGGCCTTCTTCCAAAACCTGCGGACCTGCCTTGGCCAGCA
GGATTCGAGCGAAGTAGCAGATGTTCTTGAAATTCACTGCCTCTGTCTCTTGATTGGCTATCGGGGGCGC
TATGCGCTGGGAGATAGCGGCGAGCTTCACGCCCTGCTACGACAAGCCCGGGAGCGCATCCGGCGCATTC
GCGGCGACGCGCATCTCGGTCTTCGCCCAAACTCTGTTCCTCCGGCTCTGGCCATTCCTACATCGGATAC
ATGGACGCGTCGCTTGGCATGGACGGTCTGTTTCCTCTCTGCACTCGTCTTCATTCTTTTTGTCTGGTAT
GAGGTTGAACTTAGTTCCGGCCTCCGGCTTCTGCAACGCACCATCCTCACGGTCGCCGCAAATCTCGTCA
GTCTGGAAAGAATATAA