SecReT6
Protein ID: 320106314
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1079
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1284452..1285807 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE8UX23
KEGG IDtsa:AciPR4_1079
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.10E-103, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|320106314|ref|YP_004181904.1| type VI secretion protein [Terriglobus saanensis SP1PR4]
MKFLSRLVWSEGMYLAPHHFQTQSRYYEDSIAFLANSLWRDPWGLLHIELDQKAIENGIASVLFASGIFL
DGLSFDMPVSDSAPPLRDIAPLFPTSSTELLLYLAVPARRNDGYDAQVTDASDEARYLSRMHILHDETNG
IDEREVALAHKNISIVTANEITPQLLTMPLARVVRDTRGRLRYDEDFIPACLRISASDTLMLLLQRLLQT
IGDKSETILRGSQRAQRFEPGVSALDIANYWFLHSLHSALPPLRHLIHTRHAHPADCFLELSRLAGALST
FAVDSDPRLLPEYDHRDPGAGFRGLNTYIRHHLEIVVPTNTVVLDFTSAGPFFYQAPVADERCLRRARWI
LGVRSSIAESEQLRLVPLLAKVCSARFVPELVKRALPGMALRHLSIPPMSIRAEPDMHYYSIDTSGACWE
HILQTRDVGLFLPKELGDTEFTLTAVVESSS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|320105246|ref|NC_014963.1|:c1285807-1284452 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGAAATTTCTTTCGCGTCTGGTGTGGTCCGAGGGCATGTACCTCGCGCCACATCACTTTCAGACCCAGA
GCCGTTACTACGAAGACTCCATCGCTTTTCTCGCAAACAGTCTCTGGCGTGATCCATGGGGTCTCCTCCA
CATTGAACTTGATCAAAAAGCGATAGAGAACGGAATCGCATCCGTGCTTTTTGCCTCGGGCATCTTTTTG
GATGGGCTTTCCTTTGATATGCCTGTCTCCGACTCCGCACCGCCATTACGCGATATCGCGCCACTCTTTC
CCACCTCTTCCACTGAACTGCTTCTGTACCTGGCGGTTCCTGCACGCAGAAACGATGGCTATGATGCACA
AGTGACGGATGCTTCGGACGAAGCTCGATATTTGAGCAGAATGCATATACTGCATGACGAAACAAACGGC
ATCGACGAGCGCGAAGTCGCGCTGGCCCACAAGAATATCTCGATCGTGACAGCCAATGAGATCACCCCAC
AGCTTCTGACCATGCCACTGGCCCGAGTTGTCCGCGATACCCGTGGACGCCTGCGATATGACGAGGATTT
TATTCCCGCCTGTCTGCGGATCAGCGCCAGCGATACGCTCATGCTCCTGCTGCAAAGACTTCTCCAAACG
ATAGGCGACAAGAGCGAAACCATCCTGCGCGGCTCGCAGCGAGCCCAGCGGTTTGAACCTGGCGTATCCG
CACTCGACATCGCGAATTACTGGTTCCTCCATTCGCTGCATAGCGCTCTGCCGCCTCTGCGTCATCTCAT
ACACACGCGCCATGCACATCCCGCGGATTGTTTTTTGGAGCTTTCCAGGCTAGCTGGCGCTCTCTCCACC
TTCGCTGTGGACTCCGATCCACGTCTACTGCCGGAGTATGATCATCGCGATCCAGGCGCGGGCTTTCGGG
GTCTGAATACCTACATTCGACATCATCTGGAAATCGTTGTTCCCACGAATACTGTCGTACTTGATTTCAC
CTCCGCGGGCCCTTTCTTCTATCAAGCCCCGGTGGCAGACGAGCGCTGCTTGCGGCGTGCACGCTGGATC
CTGGGAGTTCGTTCTTCGATCGCTGAATCGGAGCAGCTACGCCTCGTTCCGCTTCTCGCAAAAGTCTGCT
CAGCTCGCTTCGTGCCCGAATTAGTCAAGCGCGCTCTGCCCGGCATGGCGCTCAGGCATCTTTCGATACC
GCCCATGTCGATTCGCGCGGAACCAGACATGCACTATTACTCCATCGATACCTCCGGTGCATGCTGGGAG
CACATCCTGCAGACCCGCGATGTTGGACTCTTTCTGCCAAAAGAATTAGGCGATACAGAATTTACGCTTA
CTGCGGTTGTGGAGTCTTCGTCATGA