SecReT6
Protein ID: 320106316
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1081
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1287260..1288630 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE8UX25
KEGG IDtsa:AciPR4_1081
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.80E-114, Aligned region: 19..446
Protein Sequence: 456 a.a.     [Download]
>gi|320106316|ref|YP_004181906.1| type VI secretion protein [Terriglobus saanensis SP1PR4]
MRRLQPVAWSKGVFLSPQHLQAQDHFVEDSLRFIVEATSFRFWGFRLLQVDATAITEGSLNLLQASGFFP
DGLAFDLANADMPPQSRSLDDCFEDKKHSCVFYFAIPESRSAGINIGQRGSGLSTRFYPELQMLRDENST
GIEKPVSLARKNLKILAEGESLEGSLVLPFARVLRTEAGQYQLDREFIAPMIDANASESLTSILRSLVEV
MISLSGRLAGVRRQRNQSLADFSASDVANFWLLYTINTHLPVLHQLLQAPQVHPETVYMHLLTLAGALTT
FSKRVLPQDLPKYDHMRQGRCFLALEAILVELLNTVIPSRFLALPLRQLRDSVYVADIDVEEDTLKNSRF
YLAIASELPTAELIARTTTLVKACSATHLETLIRQALPGVALTHVPSPPQEIPVKLSFEYFSLDRAGAAW
DTIQRARNIGVYVPGEIANPRLELILLPPVGTKPRG
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|320105246|ref|NC_014963.1|:c1288630-1287260 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGCGAAGACTCCAGCCCGTCGCCTGGTCCAAAGGCGTATTTCTTTCTCCGCAACATCTCCAGGCGCAGG
ATCACTTTGTAGAAGATTCATTGCGGTTCATCGTGGAGGCAACCTCATTTCGCTTCTGGGGCTTCCGCTT
GCTTCAGGTTGACGCCACTGCAATCACCGAGGGTTCGCTCAACCTGTTGCAGGCATCGGGCTTCTTTCCG
GACGGTCTTGCCTTCGATCTCGCAAATGCGGATATGCCGCCTCAGTCACGCTCGCTGGATGACTGCTTTG
AGGACAAGAAGCATTCGTGCGTATTTTACTTCGCCATTCCAGAGAGCAGGAGTGCTGGCATTAATATCGG
ACAAAGAGGCTCCGGTCTAAGTACGCGGTTTTACCCCGAGCTCCAGATGCTTCGTGATGAGAACAGTACA
GGCATCGAGAAGCCAGTCTCTCTCGCGCGCAAAAACCTAAAAATTCTTGCAGAAGGAGAGAGTCTGGAAG
GCTCCCTTGTTCTTCCATTTGCGCGCGTGCTCCGCACTGAGGCTGGACAGTATCAGCTCGATCGGGAATT
CATCGCACCCATGATCGATGCCAACGCAAGCGAGAGCCTGACCAGTATTCTTCGTAGCTTGGTCGAGGTG
ATGATATCGCTGAGCGGTCGTCTTGCTGGCGTACGAAGGCAGCGCAATCAGTCTCTAGCGGACTTCAGTG
CCTCCGACGTAGCGAACTTCTGGCTGCTTTACACGATCAACACGCATCTGCCCGTATTGCACCAGCTGCT
ACAGGCTCCCCAGGTACATCCTGAGACGGTATATATGCACCTGCTCACGCTGGCTGGGGCGCTGACGACC
TTCTCCAAGCGCGTGCTGCCACAAGATCTGCCGAAGTACGATCACATGCGTCAAGGACGATGCTTTTTGG
CGCTGGAGGCCATCCTGGTGGAATTATTGAACACGGTCATTCCAAGCCGCTTTCTCGCGCTACCTCTTCG
CCAACTACGAGATTCCGTTTATGTGGCAGATATCGATGTAGAAGAAGATACCCTTAAAAACTCGCGTTTC
TATCTCGCGATCGCGTCCGAACTTCCGACAGCCGAACTCATTGCGCGGACCACAACACTCGTAAAGGCCT
GCTCTGCGACACATCTCGAAACGCTGATCCGCCAGGCGCTACCTGGGGTCGCCCTGACGCATGTACCATC
TCCGCCACAGGAAATTCCAGTCAAACTCAGCTTCGAGTACTTCAGTCTGGACCGGGCTGGTGCTGCCTGG
GATACCATCCAACGAGCAAGGAACATCGGGGTCTATGTGCCGGGCGAGATCGCTAACCCCAGGTTGGAAC
TTATCCTCCTGCCGCCGGTTGGGACGAAGCCACGTGGATGA