SecReT6
Protein ID: 320106317
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1082
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1288908..1289423 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDE8UX26
KEGG IDtsa:AciPR4_1082
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-56, Aligned region: 10..166
Protein Sequence: 171 a.a.     [Download]
>gi|320106317|ref|YP_004181907.1| type VI secretion protein [Terriglobus saanensis SP1PR4]
MARESTQQKLSRVRSPRVHITYDVEIGDAIENKELPFVMGILADLAGQPVTPMAPLKERKFVEINPDNFD
DVMANLQPRVAYSVPNKLSDDPNAGQLKIDVNFRSMDDFSPEQVAAKVEPLRALLELRTRLSDLRGSLQG
NDKLDEMLYEAVTNTEMREKLRLELGKTEKL
 
Nucleotide Sequence: 516 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1288908-1289423 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGCAAGAGAGTCAACACAGCAGAAGCTTAGTCGTGTGCGCAGTCCGCGCGTACATATTACCTATGACG
TTGAGATAGGTGACGCAATTGAAAATAAGGAATTGCCCTTCGTAATGGGTATTCTTGCTGATCTCGCAGG
GCAGCCTGTCACGCCAATGGCTCCGCTGAAGGAGCGTAAGTTTGTCGAGATAAACCCCGACAATTTCGAT
GACGTAATGGCAAATCTGCAGCCGCGTGTTGCTTACTCGGTGCCAAACAAGTTGTCCGATGATCCGAATG
CCGGGCAGTTGAAGATCGACGTGAATTTTCGATCGATGGATGATTTCTCACCCGAACAGGTCGCCGCTAA
GGTAGAGCCGCTACGCGCACTTTTGGAGCTGCGGACGAGGCTATCGGATTTGCGCGGCAGCTTACAGGGC
AACGACAAGTTGGACGAGATGCTCTACGAGGCGGTGACAAACACCGAAATGCGCGAGAAGCTGCGCCTTG
AATTGGGAAAGACGGAGAAGCTCTAG