SecReT6
Protein ID: 320106318
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1083
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1289424..1290923 [+]
ProductEvpB tamily type VI secretion protein
NoteTssC
UniProt IDE8UX27
KEGG IDtsa:AciPR4_1083
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-191, Aligned region: 71..494
Protein Sequence: 499 a.a.     [Download]
>gi|320106318|ref|YP_004181908.1| EvpB tamily type VI secretion protein [Terriglobus saanensis SP1PR4]
MEEAKLADSLVLTDEASEVAQEGSLLDKLVAQGRFARTAESRERGKDLIKEFISQVLEGHMTVSRDAEAA
IQERIAQIDRIISEQLNEILHHPSFQKLEGTWRGIRYLMDQSETNSMLKLKVLPVSKRELLRDLQRASEF
DQSSLFKKVYEEEFGIFGGAPFAALIGDYEFSKSPEDMDLLQRVAQVAASAHAPFLSAASPDLLNLRDFT
QLGLPRDIGKIFDTTEYAKWKSFRQSEDSRYVALTLPRVLTRLPYGKETQQIEGFDFEENVDGSDHSKYL
WSNAAYALGARLTSAFARYGWCAAIRGVEGGGLVEDLPAHTFATDEGDIALKCPTEAQITDRREKELADQ
GLVPLVHCKGTDYAAFFSVQSVNKPRLYDKDAANANARLSAQMPYILAMSRFAHYLKAMMRDKIGSFTTV
AECQKFLNNWISQYVLLDDTASQSAKARLPLREARIEVSEVPGKPGAFRAVAFLKPHFQLDELTISLRLV
ADLPDSARN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1289424-1290923 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGAAGAGGCAAAGTTGGCAGATTCGTTGGTGCTTACTGACGAGGCATCAGAAGTAGCGCAAGAAGGAT
CTCTGCTGGATAAACTCGTCGCCCAAGGGCGCTTTGCGCGAACTGCCGAGAGCAGGGAGCGTGGCAAGGA
TTTGATTAAAGAATTTATCTCGCAAGTGCTTGAAGGGCACATGACAGTATCGCGAGATGCAGAGGCGGCG
ATCCAGGAGCGTATTGCCCAGATCGATCGGATTATATCCGAGCAGCTTAACGAAATTCTGCATCATCCCT
CTTTTCAAAAGCTCGAAGGAACTTGGCGTGGAATTCGGTACTTGATGGATCAAAGCGAGACGAACAGCAT
GCTGAAGCTGAAAGTCTTGCCGGTGTCAAAGCGCGAACTGTTACGCGACCTTCAGCGTGCTTCAGAGTTT
GATCAAAGTTCCTTGTTCAAGAAAGTGTACGAAGAAGAGTTTGGTATCTTTGGCGGAGCGCCATTTGCCG
CGCTCATTGGCGATTACGAATTCAGTAAGAGCCCGGAAGACATGGACCTCCTGCAGAGGGTAGCGCAGGT
GGCAGCTTCCGCGCATGCGCCGTTCCTTTCTGCGGCTTCGCCTGACCTTTTAAATCTGCGCGACTTTACG
CAGCTAGGGCTACCAAGGGACATTGGGAAGATCTTCGACACGACCGAGTATGCGAAGTGGAAATCATTCC
GGCAGTCAGAAGATTCGCGCTACGTGGCACTTACATTGCCGCGCGTTCTTACGCGGCTGCCATATGGCAA
GGAGACACAGCAGATCGAGGGTTTTGACTTTGAAGAGAATGTAGACGGTAGCGATCACTCAAAGTATCTA
TGGAGTAATGCAGCCTATGCCCTCGGAGCGAGGCTTACCAGTGCTTTTGCAAGGTATGGCTGGTGCGCGG
CGATACGAGGTGTCGAAGGGGGAGGCTTGGTTGAAGATCTGCCAGCGCACACCTTTGCTACAGATGAGGG
AGACATCGCGCTCAAGTGTCCAACCGAGGCGCAGATCACCGATCGCCGCGAGAAGGAACTTGCCGATCAG
GGGCTTGTTCCGTTAGTGCATTGCAAGGGAACGGATTACGCTGCGTTTTTCAGCGTACAGTCTGTGAACA
AACCGCGACTGTATGACAAGGATGCAGCCAATGCGAACGCAAGGCTCTCAGCTCAGATGCCTTATATTCT
TGCGATGTCCCGCTTTGCGCACTATCTCAAGGCAATGATGCGCGACAAAATCGGAAGCTTTACCACTGTG
GCCGAATGTCAAAAGTTTCTCAATAACTGGATATCGCAATACGTGCTTTTGGATGACACCGCATCGCAAT
CGGCGAAAGCAAGACTGCCGCTGCGCGAGGCGCGGATTGAAGTGTCCGAAGTGCCCGGCAAGCCGGGCGC
CTTTCGCGCGGTGGCTTTTCTTAAGCCACATTTTCAGTTGGATGAATTGACCATCTCACTGCGATTGGTC
GCCGACCTTCCAGATTCCGCACGAAATTGA