SecReT6
Protein ID: 320106319
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1084
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1290972..1291463 [+]
Producthypothetical protein
NoteTssD
UniProt IDE8UX28
KEGG IDtsa:AciPR4_1084
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-19, Aligned region: 10..138
Protein Sequence: 163 a.a.     [Download]
>gi|320106319|ref|YP_004181909.1| hypothetical protein AciPR4_1084 [Terriglobus saanensis SP1PR4]
MAEYGMGSLFLKLDGATGEAIEPTHKNEIPVLSFSFSGHAESGSGGTAGSSGAGAMLHGINVTAIMDKGL
QTVGKLFCEGKHIATGVLSAMKATGTANKDYFTLKMTQVYIQSFNVNLSNDSAIVNLTLTYAEITPNYFQ
QQADGSMAATTSYTFNTKSGKTT
 
Nucleotide Sequence: 492 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1290972-1291463 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGCAGAGTACGGCATGGGCAGTCTATTTTTGAAGCTTGATGGAGCGACGGGTGAGGCGATCGAACCAA
CACATAAGAACGAAATTCCTGTGTTAAGTTTTAGCTTTAGCGGGCATGCTGAATCCGGCTCCGGGGGCAC
GGCCGGTTCAAGTGGAGCCGGAGCTATGCTACACGGAATCAATGTTACCGCGATTATGGACAAAGGCCTT
CAAACGGTAGGCAAATTGTTTTGCGAAGGTAAACATATAGCAACCGGAGTGTTGTCTGCCATGAAGGCTA
CTGGTACTGCTAACAAAGATTACTTCACTCTTAAAATGACACAAGTCTACATTCAAAGTTTCAACGTGAA
TTTATCAAACGACTCTGCGATCGTGAATCTTACTTTGACTTATGCAGAGATCACTCCGAATTACTTCCAG
CAGCAGGCAGATGGCAGCATGGCTGCCACGACCAGTTATACGTTCAATACGAAGTCGGGCAAGACAACCT
AA