SecReT6
Protein ID: 320106320
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1085
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1291679..1293571 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE8UX29
KEGG IDtsa:AciPR4_1085
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-15, Aligned region: 54..114
Protein Sequence: 630 a.a.     [Download]
>gi|320106320|ref|YP_004181910.1| type VI secretion-associated protein, ImpA family [Terriglobus saanensis SP1PR4]
MFLIESLMLPIREDEPSGDSLRYDRIFDQIAEARAEEDETLPTGNWERQAKRADVSQVISLTCETLQNRS
KDLWLAAWLGEASIRQEKWKALPESLNLLLRLQEEFWDSLYPEVEEGDLGLRIAPLQWAMTRYAALVYEL
PVTVEAFGFHVYQAARAIGYQADADQDEVARAARAAAIEQGKLTPEDLDVALAATSKSFYVSLVALFTET
SEVLQNLHSFCEARYGDDGPSLVKIRTAVDEVGNLALSLLRKKRELDPDPASNKPEPDDASKQSEQQDRL
DEIPPQDEAILSLVDAGTAEADLVPLPEKSTPETTAGSGDSSAFFQYDSWDSAVAQVQRCADFMFTQRPD
HPAPYLLLNSLMSSDAMTGLRVAAPSSETRLLLKQTSEEGDWTGLLQKTMTALATPFGTEWLDLHHYLWL
ASTELGYETLADCARDHVRAMYRRFGAPLIGLVFEDDTPTANSGTLQWLQRDVLDIAESETRAETSLQAA
DTEESPWSSEQELFVLANEWAASGDLQKALRVLTGDTIAANGRILFQRKLEVARLCLEAGQSLVAEPLLR
RLLDEADERHLAHWEGHGMVGSVLTLLLRSTDANGTRNEVPEENRSSIFARLCAIDAVAALAHATSVQHE
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1291679-1293571 Terriglobus saanensis SP1PR4 chromosome, complete genome
GTGTTTCTGATCGAATCCTTGATGCTGCCGATCCGAGAGGACGAACCCTCTGGAGACAGCCTCCGCTATG
ATCGGATCTTCGATCAGATTGCAGAAGCGCGTGCAGAAGAGGACGAGACCCTGCCCACTGGGAATTGGGA
GAGACAGGCAAAACGCGCAGACGTTTCTCAGGTAATTTCCCTCACATGCGAGACGCTTCAAAACCGCAGC
AAGGATCTTTGGCTGGCAGCCTGGTTGGGGGAAGCCAGTATCCGTCAGGAGAAATGGAAGGCGCTTCCCG
AGAGTCTCAATCTGCTCTTGCGCCTGCAGGAAGAGTTTTGGGATTCACTTTATCCGGAGGTTGAAGAGGG
AGACCTTGGCCTGCGCATTGCACCGCTGCAATGGGCCATGACACGGTACGCAGCACTGGTCTATGAGTTG
CCAGTAACTGTGGAAGCGTTTGGATTTCACGTGTATCAGGCCGCACGTGCGATTGGCTACCAGGCCGATG
CAGACCAGGACGAAGTAGCACGTGCGGCCCGTGCGGCAGCGATCGAGCAAGGGAAGCTGACACCGGAGGA
CTTGGATGTCGCACTCGCGGCTACGAGTAAGTCTTTCTACGTCTCCCTTGTCGCTTTGTTCACGGAAACC
AGCGAAGTTTTGCAGAACCTCCACTCCTTCTGCGAAGCGCGATACGGCGACGACGGGCCTTCGCTCGTTA
AGATCCGAACAGCAGTGGACGAGGTGGGCAACCTGGCCTTGTCGCTGTTGCGAAAGAAGCGAGAGCTGGA
TCCAGATCCGGCCTCCAACAAGCCGGAGCCCGACGATGCGTCAAAGCAGTCAGAACAGCAGGACCGACTA
GACGAAATACCACCGCAAGACGAAGCGATACTGTCTTTAGTCGATGCTGGAACTGCAGAAGCTGATTTGG
TGCCTCTACCCGAGAAGAGCACTCCGGAAACTACAGCAGGCTCGGGCGATTCGAGTGCATTCTTTCAGTA
TGATTCCTGGGATTCTGCCGTTGCTCAGGTTCAGCGATGTGCGGATTTCATGTTTACTCAGCGGCCAGAT
CATCCGGCTCCCTATTTGCTGCTCAACTCTCTCATGTCTTCGGACGCGATGACCGGCCTACGTGTGGCAG
CACCTTCCAGCGAGACGCGGCTACTACTAAAGCAGACGAGTGAAGAAGGCGACTGGACCGGCCTCCTCCA
AAAAACGATGACCGCGTTGGCAACACCCTTCGGTACTGAGTGGCTGGATCTACATCATTACCTGTGGCTT
GCCAGCACGGAACTCGGTTATGAGACCTTGGCAGACTGTGCGCGGGATCATGTGCGAGCAATGTATCGGC
GATTTGGGGCTCCCTTGATAGGGCTGGTCTTCGAAGACGATACTCCCACTGCAAACAGTGGCACGCTGCA
ATGGCTCCAGCGTGATGTTCTGGATATAGCGGAGAGCGAGACCCGAGCGGAAACGTCATTGCAAGCTGCC
GATACGGAGGAATCTCCTTGGTCTTCAGAGCAAGAGCTTTTTGTGTTGGCCAACGAGTGGGCCGCGAGTG
GAGATCTACAAAAGGCTTTGCGCGTGTTGACCGGGGACACGATAGCTGCCAATGGGCGCATTCTTTTTCA
ACGCAAACTGGAGGTTGCGAGGCTCTGTCTTGAGGCTGGCCAGAGTCTCGTAGCCGAGCCGCTATTACGG
CGGTTGTTGGATGAAGCTGATGAGCGTCATCTAGCGCATTGGGAGGGGCATGGCATGGTGGGAAGTGTCC
TCACATTGTTGTTGCGCTCTACAGATGCGAATGGTACCCGAAATGAGGTTCCAGAAGAAAACCGGAGCTC
GATTTTTGCGCGACTTTGCGCAATCGATGCTGTAGCGGCGCTTGCCCATGCTACCAGTGTTCAGCATGAG
TAA