SecReT6
Protein ID: 320106321
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1086
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1293546..1294025 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE8UX30
KEGG IDtsa:AciPR4_1086
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-18, Aligned region: 38..141
Protein Sequence: 159 a.a.     [Download]
>gi|320106321|ref|YP_004181911.1| type VI secretion system lysozyme-like protein [Terriglobus saanensis SP1PR4]
MLPVFSMSNTRETIFVQSVLDRLREKTSWPTTRAASLRYLKEAIRRDIEDLLNTRRPPIPEIENYPLANV
SVLNMGLQDISQLGSSADGRLEEIQRAVQQCIETFEPRLQNLIVTAKNGSTPRREIWLTIEATIQVQPAA
ETISFDTMLDLTSGMYSVK
 
Nucleotide Sequence: 480 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1293546-1294025 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGCTACCAGTGTTCAGCATGAGTAATACCAGAGAGACAATTTTCGTGCAGTCGGTGTTAGACCGGCTAA
GAGAGAAAACAAGTTGGCCAACAACGCGAGCCGCATCGCTTCGCTATTTGAAGGAAGCGATTCGCAGAGA
TATTGAAGACCTACTTAATACGCGGCGACCTCCAATTCCTGAGATCGAAAACTATCCGTTGGCCAACGTA
TCGGTTTTAAACATGGGACTGCAGGACATCAGTCAGCTTGGCAGTTCAGCGGACGGACGTCTGGAAGAGA
TTCAGCGGGCTGTGCAGCAATGTATCGAGACATTCGAACCCCGTCTGCAGAACCTTATCGTGACGGCGAA
AAACGGTAGCACACCGCGACGTGAGATCTGGCTCACCATCGAAGCGACGATCCAGGTGCAACCGGCGGCA
GAAACGATTTCGTTCGACACCATGCTTGATTTGACGAGCGGAATGTACTCGGTGAAATAG