SecReT6
Protein ID: 320106322
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1087
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1294028..1295869 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDE8UX31
KEGG IDtsa:AciPR4_1087
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-199, Aligned region: 5..612
Protein Sequence: 613 a.a.     [Download]
>gi|320106322|ref|YP_004181912.1| type VI secretion protein [Terriglobus saanensis SP1PR4]
MAKPLLEYYERELAYLRQMGAEFGERYPAIAGRLLLESDRCGDPHVERMLEAFSFLAARIHVRLDDDLPE
LTEGMLDIIYPHYLRPIPAMSIAQFTFDREASSLGAAVVVPAQSELITRRTMGGEPCRFQTSYPVDLWPI
EIKECVWRRPEQIKSPARVPDAVGVLRVLLRASEGASLKQLKLERLNFYLGGEKSLMLSLYELLCRNLLQ
VVVRDPQSSETRKILLHRRCVQPMGFDEDESILPYTQRSFHGYRLLQEYFSFSEKFLFFSVNGLAEAMLL
AESGELEVLFYFSQFDQPERAQALEMGVGVGSMKLGCTPIVNLFRQTAEPILVSNAKHAYRVNPSSRHHR
MTEIFSIDEVKATNPSRRSSTTLRPLFEHRFHRSSEEEHIFWRSSRKQAEFDQRRPSEVFLTIVDRNSVM
MQPNAEILNVHCTCTNHDYPSSLSFGDPGGDFDLQGGGGVGPIQMLHRPTATSSPPAVAGQVWSLISQLS
LNHLSLSEGGLQALKEILRLHNFTESPHLDRQIDGIRSFKSARHIALMQSEHGSVAARGTRIELELDEEE
FVGGGAYLFSAVLNRFFGLYVSMNSFSQLSVRSTQRKEGIEEWLPRAGSQVVM
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1294028-1295869 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGCAAAGCCGCTTTTGGAATATTACGAGCGCGAACTCGCTTACCTCCGCCAGATGGGCGCTGAGTTTG
GCGAACGCTATCCCGCGATTGCGGGTCGGCTACTGCTTGAGTCAGACCGCTGTGGCGATCCGCATGTAGA
GCGGATGCTTGAGGCCTTTTCGTTTCTCGCAGCGCGCATACATGTCCGGCTCGACGACGATCTTCCTGAA
CTAACGGAGGGCATGCTCGACATCATTTATCCGCATTATCTTCGGCCGATTCCGGCGATGTCGATCGCTC
AATTCACGTTCGACCGGGAGGCAAGTTCGCTCGGTGCAGCTGTCGTGGTTCCAGCGCAAAGTGAACTGAT
CACCAGACGAACGATGGGCGGTGAGCCATGCCGATTCCAAACAAGCTACCCTGTCGATCTTTGGCCCATA
GAAATAAAGGAATGCGTTTGGCGTCGGCCAGAGCAAATTAAATCGCCAGCGCGAGTACCAGATGCTGTGG
GCGTATTGAGAGTTCTGCTCCGAGCGAGCGAAGGAGCTTCCTTAAAACAGCTCAAGCTGGAGCGGCTCAA
CTTCTATCTCGGTGGAGAAAAGAGTCTGATGCTCTCGCTGTATGAATTGCTCTGCCGCAATCTGTTGCAG
GTTGTGGTGCGTGATCCGCAATCGTCAGAGACGCGAAAAATCCTCCTTCATCGCAGATGCGTTCAGCCGA
TGGGGTTTGACGAGGACGAAAGTATTCTTCCGTACACTCAAAGGTCTTTTCATGGCTATCGATTGCTGCA
AGAGTACTTCAGCTTTTCTGAAAAATTTCTCTTCTTCTCCGTAAACGGACTTGCAGAAGCGATGTTGCTG
GCTGAGTCAGGAGAACTCGAAGTGTTGTTCTACTTTTCGCAGTTTGATCAGCCAGAGCGCGCACAGGCAC
TCGAAATGGGCGTAGGGGTTGGGTCGATGAAGCTCGGCTGTACGCCGATTGTGAATCTCTTTCGGCAGAC
CGCCGAGCCGATACTTGTCTCGAACGCGAAGCATGCCTATCGCGTTAACCCGAGTTCTCGACACCATCGC
ATGACAGAGATCTTCTCTATCGATGAGGTGAAGGCGACTAATCCTTCGCGCCGAAGTTCAACCACGCTGC
GACCTCTTTTTGAGCACCGTTTTCACAGGTCATCGGAAGAAGAACACATCTTCTGGAGATCCAGCAGAAA
GCAAGCGGAGTTCGATCAGAGACGTCCGAGCGAAGTCTTCCTGACGATCGTTGATCGAAACAGTGTGATG
ATGCAGCCCAATGCCGAGATCCTTAACGTGCACTGCACCTGCACCAACCATGACTATCCCTCCAGTCTTT
CCTTCGGCGATCCGGGCGGCGATTTCGATCTGCAGGGAGGTGGGGGAGTAGGACCTATCCAAATGCTGCA
CAGGCCGACGGCGACCTCTTCTCCACCCGCAGTCGCGGGTCAGGTCTGGAGCCTGATATCTCAACTTTCT
CTGAATCATCTCTCGCTCAGCGAGGGTGGTCTTCAGGCTCTGAAGGAGATCCTGCGGCTGCACAACTTTA
CCGAGTCTCCACATCTCGATCGGCAGATTGACGGCATACGTTCCTTTAAGAGTGCACGGCATATCGCCTT
GATGCAGAGCGAACACGGAAGCGTCGCGGCGCGTGGAACCCGTATCGAACTCGAGTTGGATGAGGAAGAG
TTTGTCGGTGGCGGCGCTTACCTGTTCTCCGCCGTACTTAATCGTTTCTTTGGACTGTATGTCTCGATGA
ACAGCTTTTCGCAGCTATCGGTACGCAGCACTCAGAGAAAGGAGGGAATAGAGGAATGGTTACCAAGAGC
AGGCAGTCAAGTGGTGATGTAG