SecReT6
Protein ID: 320106323
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1088
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1295833..1296894 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDE8UX32
KEGG IDtsa:AciPR4_1088
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-101, Aligned region: 23..337
Protein Sequence: 353 a.a.     [Download]
>gi|320106323|ref|YP_004181913.1| type VI secretion protein [Terriglobus saanensis SP1PR4]
MVTKSRQSSGDVGGKAMRKWMEEEPWNIGFFQMVRILERLHPDRKPVGIFVPPGDEVVRFSAPPDLTFPP
SEIRSFVESVSGPACMDVSFMGLNTVNGPMPRSYTEGLLERAREGDQATLDFFDLFNHRLISLFYRAWKK
YRFFLAYEESADGSDGMTGRLYSLIGLGTPALNNRMAIADEAALHYAGLLAHRVRSVEGLRQILTHYFGI
RVEIAQFSGAWVKLPLEQRTTLDEGENFSDSLGVGTVVGDEVWDQQGAMTVRLGPMSIDRYRDFLPGSKG
YWELEAWLRLYSRQEFDFTIRLLLARDEVPATVLATGFGEAAGVGQGNRLGYESWLKVKPMNRDPDETTY
VLG
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1295833-1296894 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGTTACCAAGAGCAGGCAGTCAAGTGGTGATGTAGGCGGCAAAGCAATGCGGAAGTGGATGGAAGAAG
AGCCTTGGAATATCGGCTTTTTCCAGATGGTGCGCATCCTGGAGCGCCTGCATCCGGACCGCAAACCGGT
TGGCATCTTTGTTCCTCCAGGAGATGAGGTTGTACGGTTTTCAGCACCGCCTGATCTCACCTTCCCTCCG
AGCGAAATCAGGAGCTTCGTGGAGAGCGTCAGCGGCCCGGCATGCATGGACGTAAGCTTCATGGGTCTCA
ATACGGTGAACGGACCTATGCCGCGATCCTATACGGAAGGCCTGTTGGAGCGTGCGCGCGAGGGGGACCA
AGCCACGCTGGACTTCTTCGATCTCTTCAATCATCGTCTGATTTCGCTCTTTTATCGTGCGTGGAAGAAG
TATCGATTCTTCCTCGCTTACGAAGAGTCTGCGGATGGCAGCGATGGTATGACAGGCCGTTTATACAGCC
TTATAGGTCTTGGCACGCCTGCGCTGAACAACAGGATGGCAATCGCTGACGAAGCCGCGCTTCATTACGC
CGGCCTGTTAGCTCACCGCGTGCGATCAGTCGAGGGGCTGCGACAGATCCTGACACACTATTTCGGGATC
CGCGTGGAGATTGCACAATTTTCTGGAGCATGGGTCAAACTGCCGCTGGAGCAGAGGACCACGCTCGACG
AGGGAGAAAACTTTTCTGATTCTCTCGGCGTCGGCACAGTCGTGGGCGATGAAGTCTGGGACCAACAGGG
AGCAATGACGGTGCGACTCGGTCCCATGTCGATTGACCGGTATCGGGATTTTCTGCCCGGCTCAAAGGGT
TACTGGGAGCTTGAGGCATGGCTCAGGCTTTATTCGCGACAGGAATTCGATTTCACGATTCGGCTTCTGC
TTGCCCGTGATGAAGTTCCCGCAACCGTACTCGCGACTGGCTTTGGAGAAGCTGCGGGCGTTGGCCAAGG
TAACCGGTTGGGCTACGAAAGTTGGCTCAAGGTGAAACCTATGAACAGAGATCCAGATGAAACCACTTAT
GTATTGGGATAA