SecReT6
Protein ID: 320106324
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1089
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1296913..1299576 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8UX33
KEGG IDtsa:AciPR4_1089
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-36, Aligned region: 226..247
AAA_2 [PF07724], Evalue: 1.60E-36, Aligned region: 607..772
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 226..357
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 613..736
ClpB_D2-small [PF10431], Evalue: 4.00E-15, Aligned region: 782..854
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 203..248
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 269..304
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 411..522
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 605..648
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 678..701
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 226..256
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 612..732
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 225..307
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 342..386
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 610..634
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 673..706
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 205..305
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 582..728
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 226..251
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 610..634
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 226..361
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 457..481
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 562..582
AAA_14 [PF13173], Evalue: 1.50E-05, Aligned region: 611..693
AAA_25 [PF13481], Evalue: 5.70E-05, Aligned region: 226..289
AAA_25 [PF13481], Evalue: 5.70E-05, Aligned region: 610..629
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 219..243
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 610..637
NACHT [PF05729], Evalue: 0.00013, Aligned region: 226..253
NACHT [PF05729], Evalue: 0.00013, Aligned region: 612..640
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 226..272
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 612..647
IstB_IS21 [PF01695], Evalue: 0.00027, Aligned region: 131..180
IstB_IS21 [PF01695], Evalue: 0.00027, Aligned region: 208..245
IstB_IS21 [PF01695], Evalue: 0.00027, Aligned region: 612..630
Zeta_toxin [PF06414], Evalue: 0.00064, Aligned region: 222..247
Zeta_toxin [PF06414], Evalue: 0.00064, Aligned region: 606..652
Arch_ATPase [PF01637], Evalue: 0.00077, Aligned region: 112..152
Arch_ATPase [PF01637], Evalue: 0.00077, Aligned region: 205..243
Arch_ATPase [PF01637], Evalue: 0.00077, Aligned region: 279..374
Arch_ATPase [PF01637], Evalue: 0.00077, Aligned region: 611..624
AAA_18 [PF13238], Evalue: 0.00091, Aligned region: 226..249
AAA_18 [PF13238], Evalue: 0.00091, Aligned region: 613..637
T2SE [PF00437], Evalue: 0.0015, Aligned region: 137..247
T2SE [PF00437], Evalue: 0.0015, Aligned region: 600..643
AAA_30 [PF13604], Evalue: 0.0023, Aligned region: 211..249
AAA_30 [PF13604], Evalue: 0.0023, Aligned region: 611..639
AAA_30 [PF13604], Evalue: 0.0023, Aligned region: 680..694
Hpr_kinase_C [PF07475], Evalue: 0.0035, Aligned region: 125..190
Hpr_kinase_C [PF07475], Evalue: 0.0035, Aligned region: 226..238
Hpr_kinase_C [PF07475], Evalue: 0.0035, Aligned region: 610..629
DUF2075 [PF09848], Evalue: 0.0055, Aligned region: 226..328
DUF2075 [PF09848], Evalue: 0.0055, Aligned region: 674..691
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 226..242
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 445..506
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 610..704
Protein Sequence: 887 a.a.     [Download]
>gi|320106324|ref|YP_004181914.1| type VI secretion ATPase, ClpV1 family [Terriglobus saanensis SP1PR4]
MVLSLKSLVAKFDGSTRDAMEGAAGLCVSGTHYQVEIEHFLVKALEQKDADLHYIFRHFEVDSSKLVVEL
RKSLDRLKTGNTRGPSFSPMLVTMFSEAWSIATLNYADTRIRTGHVLLALLANDEMLRLLREISREMKKI
SLEVLSEQFEEITTSSIEIPAEVPVESGSNGSKIPRVTSATPFLQQYTTNLTQNAREGKLDAVIGRNAEI
RQMIDVLMRKRQNNPILTGEAGVGKTAVVEGLAARIAAGEVPPALQNVQLHALDLALLHAGAGVKGEFEN
RLKGLIQEVKSSPQPVILFIDEAHTMIGAGGPAGQGDAANLLKPALARGELRTIAATTWSEYKRYFEKDA
ALARRFQVVHVQEPSEERCVAMLRGLLPALELHHGVRIMDDALIAAVRLSHRYMPGRQLPDKAVSVLDTA
CARVGLSLSAAPSALEEIMHRIATLESQERVLLREQATGSSHKDALLEITTSLEGAKGELREMQARWAEE
RDIVDHLHVLRAKLEGTEIEATLRETTLRELATAKIELFDLQQGKPLTYVGVDQQIVGEVISEWTGIPLG
KMLADEVSRILDLEDSLKKRVIGQDHAMKAIAQRVQTSRANLDDPSKPIGVFLLAGPSGVGKTETALALT
DLLYGGEQNLITINMSEFHEPHSVSTLKGAPPGYVGYGEGGVLTEAVRRQPYSVVLLDEAEKAHPEVLEL
FFQVFDKGYMEDGEGRGIDFRNTLILLTTNTASGIISKLAEDPHALPAPLALASAIRPELNRVFKPALLG
RMLVVPYYPVQDEVLERIIRLKLNKIQARLMANHHIALDYDESLLTLIRQRCMEVETGARNVDHLISNTI
LPEISKQLLERMAEEDLLESIWLGVSENGAIRYEWTILESDELVSQA
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1296913-1299576 Terriglobus saanensis SP1PR4 chromosome, complete genome
ATGGTACTGAGTCTGAAATCGCTGGTAGCAAAATTTGATGGAAGTACGCGGGATGCAATGGAGGGCGCTG
CGGGCCTCTGTGTTTCGGGCACACATTACCAGGTTGAGATTGAACATTTTCTCGTCAAGGCGCTTGAGCA
GAAAGACGCGGATCTGCACTATATCTTCCGCCATTTTGAGGTTGACTCGTCAAAGCTCGTAGTAGAACTG
CGAAAGAGTCTGGATCGACTGAAAACAGGGAACACGCGTGGACCTTCCTTCAGTCCGATGCTGGTCACCA
TGTTTTCTGAGGCGTGGTCCATCGCCACGTTGAATTACGCAGACACACGTATTCGCACAGGCCACGTACT
CTTAGCGCTGCTGGCGAATGACGAAATGTTGCGATTGCTGCGAGAGATCAGCCGCGAGATGAAGAAGATC
TCACTCGAAGTATTGAGCGAGCAATTTGAGGAGATCACGACGTCCTCAATCGAGATTCCGGCGGAGGTGC
CTGTCGAATCGGGTAGTAACGGGTCCAAGATTCCAAGGGTAACCTCTGCTACGCCGTTTTTGCAGCAGTA
CACCACGAATCTCACGCAGAATGCGCGAGAGGGCAAACTCGATGCGGTCATCGGGCGTAACGCAGAAATC
CGCCAGATGATCGATGTCCTGATGCGCAAGCGACAGAACAATCCGATTCTGACTGGCGAGGCCGGTGTGG
GAAAGACCGCAGTCGTAGAGGGACTGGCCGCGCGCATTGCTGCTGGCGAAGTTCCACCCGCGTTGCAGAA
CGTGCAGCTTCACGCGCTGGACCTTGCACTGCTGCACGCAGGCGCCGGAGTCAAGGGTGAGTTTGAAAAT
CGGTTGAAGGGCTTGATTCAGGAGGTGAAGTCCTCTCCACAACCGGTGATCCTCTTCATTGACGAAGCGC
ACACCATGATCGGGGCTGGCGGGCCCGCAGGACAGGGAGACGCAGCTAATTTGTTGAAGCCGGCTCTGGC
GCGCGGCGAACTGCGCACGATCGCCGCCACCACATGGTCGGAGTACAAACGCTACTTTGAAAAAGATGCA
GCACTGGCTCGGCGATTCCAGGTGGTTCACGTTCAAGAGCCTTCGGAGGAACGCTGTGTTGCCATGTTGC
GCGGTCTCTTGCCCGCGCTCGAACTGCATCACGGCGTCCGGATCATGGACGATGCTTTGATTGCGGCGGT
CCGTCTCTCGCATCGCTATATGCCTGGTCGTCAGTTACCGGACAAGGCCGTCAGTGTGCTTGATACCGCG
TGCGCACGAGTGGGTCTGAGCCTGAGCGCCGCACCCTCGGCACTGGAAGAAATCATGCATCGCATCGCGA
CTCTGGAATCGCAAGAACGCGTGCTACTCAGGGAGCAGGCTACCGGAAGTTCACACAAGGATGCGCTGTT
GGAGATCACAACTTCGTTGGAAGGCGCAAAGGGCGAACTTCGAGAAATGCAGGCAAGGTGGGCGGAGGAG
CGCGACATCGTTGACCACCTGCATGTGCTTCGGGCCAAACTGGAAGGAACAGAGATCGAGGCGACCCTGC
GGGAAACAACATTGCGCGAGCTTGCTACGGCCAAAATCGAACTCTTCGATCTGCAGCAGGGAAAACCCTT
GACCTATGTTGGTGTAGATCAGCAGATCGTTGGCGAGGTCATCTCGGAGTGGACTGGTATTCCGCTCGGT
AAGATGCTTGCAGACGAAGTGTCGCGCATCCTCGACCTCGAAGACAGTCTGAAGAAGCGTGTCATCGGCC
AGGATCATGCGATGAAAGCCATCGCTCAGCGGGTTCAGACGTCGCGAGCCAACCTTGACGATCCATCCAA
ACCGATCGGAGTTTTTCTGCTTGCCGGACCAAGCGGTGTTGGCAAGACGGAGACAGCCCTGGCTCTTACC
GATCTACTCTATGGCGGCGAGCAAAATCTGATCACGATCAATATGTCGGAGTTTCACGAACCACATTCGG
TATCGACGCTTAAGGGAGCACCTCCCGGCTACGTGGGATACGGCGAGGGAGGAGTACTCACCGAGGCGGT
GAGAAGGCAACCGTATTCGGTCGTGCTGCTTGACGAAGCGGAAAAGGCGCACCCCGAGGTGCTGGAGCTG
TTCTTCCAGGTCTTTGACAAGGGATACATGGAGGACGGGGAAGGGCGAGGCATCGACTTCCGCAACACGC
TTATTCTGCTCACGACCAACACGGCAAGCGGAATAATCTCCAAACTTGCCGAGGATCCCCATGCGCTGCC
AGCCCCCTTGGCGTTGGCTTCTGCGATCCGGCCGGAGCTGAACCGCGTCTTCAAACCTGCGTTGTTGGGA
CGCATGCTCGTCGTGCCCTATTACCCGGTGCAGGACGAAGTACTTGAGCGGATCATCCGATTGAAACTCA
ACAAAATTCAAGCGCGGCTCATGGCAAATCACCATATTGCATTGGACTATGACGAATCGCTTCTCACGTT
GATCCGGCAGCGTTGTATGGAGGTCGAAACCGGCGCGCGCAATGTGGATCACCTTATTTCCAACACGATT
CTGCCCGAGATTTCAAAACAGCTTCTGGAGCGCATGGCTGAAGAAGACCTGCTTGAGAGTATTTGGCTCG
GGGTTTCAGAGAACGGAGCCATCCGCTACGAATGGACGATTTTGGAGTCAGACGAGTTGGTTTCGCAAGC
CTGA