SecReT6
Protein ID: 320106325
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1090
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1299628..1301694 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDE8UX34
KEGG IDtsa:AciPR4_1090
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-61, Aligned region: 30..345
Phage_base_V [PF04717], Evalue: 3.70E-16, Aligned region: 391..480
Protein Sequence: 688 a.a.     [Download]
>gi|320106325|ref|YP_004181915.1| ImpA family type VI secretion-associated protein [Terriglobus saanensis SP1PR4]
MSTYTQANRVLNFTSPLGANALLAAAFEGTEEISEMFNFQIDLLSLPETVISPSELVGKRVTLQIRLNEA
GIYRPFNGIVSSLEMTGTDTFFNYYRVRMVPSLWLLSLNLQTRVFQNKTVLEIVQAVLEPYSILLSIETH
ASYETLEYCTQYRETDLNFVLRLLQQHGIFFYFTHTTSAHRLVLSDDSSHLSACPVFSEFPYREYHVALP
GMYVPYVSVFSSRASLISGEHTHWDFRFMQYAASKSNPKTSKSNSSLGNNAHEIYDYSDAASAPLKTEAA
DAKTSLLQKHLQEVARAASDAHAIECQGRSTASTMQAGFTFTLQNHRQTQQNIKYLITQVHHVAVQYPLY
RAELDTQINEPYENNFVAKPFTQPYRKAQTLLKPRVNGVVTGKVVTPAGEDSHLDKYGRVCVQFWWDRQR
PPNSTDNTLLRVSQQWAGKGWGTYFWPRANDEVLIDFLDGDPDAPIVAGSIYNGVNMPKYDPVLEYTRSG
IVTRSSKQGTAEQANELRFDDLKGSEQIFINAQRDFDVHVENDQHTKIDHEEHLTVTKDQYHAIGGASQL
KVTEDRLVEVGGNREDSIQGSQLLSVGMNHSLKVGGSQFSKSGVAHVIQAGEEIHISGGVRVIIDGGPAG
ICLMSGGSAISIDASGIALQGAMRMGKADCLPPSPVPEAAPAKNVSPPKWPGDDPRKK
 
Nucleotide Sequence: 2067 bp     [Download]
>gi|320105246|ref|NC_014963.1|:1299628-1301694 Terriglobus saanensis SP1PR4 chromosome, complete genome
TTGTCGACCTATACTCAAGCTAATCGAGTCCTCAACTTCACCAGTCCGCTTGGTGCTAATGCGCTTCTGG
CGGCTGCGTTTGAAGGTACGGAGGAGATCTCCGAGATGTTTAACTTTCAGATAGACCTGCTCTCACTCCC
GGAAACTGTGATCTCCCCGAGCGAGCTTGTGGGCAAGCGTGTAACGCTCCAGATCCGCCTGAACGAAGCT
GGCATTTACAGGCCGTTCAACGGCATTGTCTCCAGTCTGGAAATGACCGGTACCGACACGTTCTTCAACT
ACTACCGCGTGCGTATGGTTCCGTCGCTCTGGCTCCTATCGCTGAACCTCCAAACGCGCGTCTTCCAAAA
TAAGACTGTGCTCGAGATTGTTCAGGCGGTCCTTGAGCCATATAGCATCCTGTTATCGATCGAGACGCAC
GCCAGTTATGAAACTCTCGAATACTGCACCCAGTATCGGGAAACCGATCTGAATTTTGTTCTGCGTCTTC
TGCAGCAGCATGGGATTTTCTTTTACTTCACGCACACGACCTCCGCTCATCGCTTGGTGCTTTCCGACGA
TTCCAGCCATTTGTCCGCATGCCCGGTCTTCAGCGAATTTCCGTACCGGGAATATCATGTAGCTCTACCC
GGCATGTATGTTCCATATGTTTCCGTATTTTCTTCCAGAGCCTCGCTCATCTCCGGCGAACATACTCACT
GGGATTTCCGATTTATGCAATACGCTGCTTCCAAAAGCAATCCAAAAACCTCGAAGTCGAACAGTAGTTT
GGGAAACAACGCTCATGAAATATATGACTACTCCGATGCTGCGTCGGCCCCTTTGAAGACCGAGGCTGCC
GATGCAAAGACAAGCTTACTGCAGAAGCATTTACAGGAGGTTGCGCGGGCCGCTTCGGACGCGCACGCTA
TTGAATGTCAGGGACGATCGACAGCGAGCACCATGCAGGCCGGTTTCACCTTCACCCTGCAGAACCACCG
CCAGACGCAGCAAAATATAAAATATCTGATCACACAAGTCCATCACGTTGCTGTTCAGTACCCGCTCTAC
CGGGCAGAGCTTGATACGCAGATAAACGAGCCTTACGAAAACAATTTTGTGGCAAAGCCATTTACACAGC
CTTACCGAAAAGCGCAAACCTTACTTAAGCCCCGCGTCAACGGTGTGGTTACGGGTAAAGTGGTCACGCC
AGCAGGTGAGGATTCCCATCTCGATAAATACGGAAGAGTCTGTGTGCAATTCTGGTGGGATCGGCAACGT
CCGCCAAACAGTACGGACAATACACTCTTGCGCGTCTCGCAGCAGTGGGCGGGGAAGGGTTGGGGCACTT
ACTTCTGGCCCCGCGCCAACGACGAGGTACTGATTGACTTTCTCGATGGAGACCCCGACGCACCGATCGT
AGCAGGATCCATCTACAACGGCGTCAATATGCCGAAGTACGACCCAGTCCTGGAATATACACGCTCAGGT
ATCGTTACCCGATCGTCAAAGCAGGGTACCGCAGAGCAAGCCAATGAACTTCGTTTTGACGATTTAAAAG
GGTCGGAGCAGATATTTATCAATGCGCAGCGCGACTTCGATGTGCATGTGGAAAATGACCAGCATACAAA
GATCGATCACGAGGAGCACCTGACGGTAACCAAGGATCAATACCATGCAATCGGTGGAGCGTCGCAACTC
AAGGTGACGGAAGATCGCTTGGTAGAAGTAGGTGGTAACCGTGAAGACAGTATCCAAGGGAGCCAGTTGC
TCTCCGTCGGCATGAACCACAGCTTGAAGGTCGGAGGAAGTCAGTTCAGCAAGAGCGGTGTCGCCCACGT
GATTCAGGCCGGAGAAGAGATCCACATCTCCGGAGGAGTGAGGGTGATCATCGATGGAGGCCCCGCAGGC
ATATGCCTCATGAGTGGAGGAAGCGCGATTTCGATTGACGCCTCAGGGATTGCATTGCAAGGTGCGATGC
GTATGGGAAAGGCTGACTGTCTTCCACCCTCGCCTGTACCAGAAGCAGCACCTGCCAAAAATGTAAGCCC
CCCAAAATGGCCAGGTGATGACCCGAGGAAAAAATAA