SecReT6
Protein ID: 322420521
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3025
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3587914..3589803 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDE8WHR8
KEGG IDgeb:GM18_3025
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-77, Aligned region: 29..337
Phage_GPD [PF05954], Evalue: 6.20E-77, Aligned region: 516..547
Phage_base_V [PF04717], Evalue: 1.60E-24, Aligned region: 372..464
DUF2345 [PF10106], Evalue: 0.00068, Aligned region: 561..608
DUF2917 [PF11142], Evalue: 0.0014, Aligned region: 536..585
Protein Sequence: 629 a.a.     [Download]
>gi|322420521|ref|YP_004199744.1| ImpA family type VI secretion-associated protein [Geobacter sp. M18]
MAYTQDDKLISITTSLGKDVLLLTEISGEEAVSRSFRFELALVSEKQTIHHDAIIGRNATVTIALADGGK
RYFNGIISSFSQGRGGGEGGEDARFSYYRCTMVPWFWSLSNCAGTKIFQNLSIPGIVEQVFKDRGCSDYR
FDLRGSYEKREFCVQYRETDFNFVSRLLEEEGIFYFFQHEKGKHTMVLADSPEANATCPSRQAVSCLASA
SGTHENEVITALEITRQMRPSKYSLNDFNFKIPKTSLKVEVPGAARSKAEECDIYDAPAGFDTRAAGCRL
ARMRMEEEEAQSVVISGSSDCRSFTSGYRFTLTDHSNPDLNGKDLLLVSVRHDAIEGYGTDAISNYQNSF
HCIPFHTPYRPPRLTPKPVVQGTQTAIVVGPPGEEIHTDEHGRVKVQFHWDRDGKHDDNSSCWIRVSQLW
VGNGWGCFHLPRVGQEVLVDFLEGDPDRPIIIGQLHNGVNRPPYPLPAQRSMSGIKSSSTPGGEGSNEVR
FEDRKGEEEVFIHAERQQVNRVEEDSREWVGQDRHVEVGRDRFETVSRDQRLTVRGAVTVTVGADFRQQV
ADRHTLQAGQEIHLAAGGELVLDAGARITMQVGGSRIMIDPGGITLVGNISRGGLSASAPKAIEEPSEV
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3589803-3587914 Geobacter sp. M18 chromosome, complete genome
ATGGCGTACACACAGGACGACAAACTTATCTCCATTACGACTTCCCTTGGGAAGGACGTGTTGTTGCTCA
CGGAGATCTCCGGGGAGGAGGCGGTCTCCCGGAGCTTCAGATTCGAGTTGGCTCTCGTCTCTGAGAAACA
GACAATCCACCATGATGCAATCATTGGCAGGAACGCCACCGTCACCATCGCTCTTGCCGACGGTGGCAAG
CGGTACTTCAATGGGATTATCTCATCCTTTTCACAGGGCAGGGGAGGCGGAGAGGGCGGCGAGGATGCAC
GATTCTCCTATTATCGTTGCACCATGGTTCCCTGGTTCTGGAGCCTCAGCAACTGTGCCGGTACGAAGAT
ATTCCAGAACCTGTCGATTCCCGGGATCGTGGAGCAGGTTTTCAAAGACCGGGGCTGCTCCGACTACAGG
TTCGATCTGCGCGGGAGCTATGAAAAAAGAGAGTTCTGCGTTCAGTATCGAGAGACGGATTTCAACTTTG
TGTCGCGGTTATTGGAGGAGGAGGGAATCTTCTATTTCTTTCAGCATGAAAAGGGCAAGCACACGATGGT
TCTGGCCGACAGCCCCGAGGCTAATGCCACGTGTCCGTCCCGGCAAGCGGTCTCCTGTCTGGCGAGCGCA
AGCGGCACCCATGAAAATGAGGTGATCACCGCTTTGGAAATAACACGCCAAATGCGCCCGTCGAAATACT
CCCTTAACGATTTCAACTTCAAGATACCCAAGACCAGCCTGAAAGTCGAAGTCCCGGGTGCTGCCCGATC
GAAGGCGGAGGAGTGTGATATCTACGATGCTCCCGCCGGTTTCGACACAAGAGCTGCCGGCTGCAGACTG
GCAAGGATGCGCATGGAGGAGGAAGAGGCACAGTCTGTAGTGATATCGGGAAGCAGCGACTGCCGCTCCT
TCACCAGCGGCTATCGCTTCACTTTGACGGATCACAGCAATCCTGACTTGAACGGCAAGGACTTGCTCCT
CGTCTCCGTGAGGCACGACGCCATCGAAGGTTACGGCACGGATGCGATATCCAACTACCAAAACAGCTTC
CATTGCATCCCCTTTCATACACCGTACCGTCCGCCCCGCCTGACGCCCAAGCCCGTGGTGCAGGGAACGC
AGACCGCCATCGTGGTTGGACCCCCGGGGGAGGAGATCCATACGGACGAACACGGACGCGTCAAAGTCCA
ATTCCACTGGGACCGGGACGGGAAGCATGATGACAACAGTTCCTGCTGGATCAGGGTGAGCCAGTTGTGG
GTTGGCAACGGCTGGGGCTGCTTCCATCTGCCGCGTGTCGGGCAGGAGGTGCTGGTGGACTTTCTGGAAG
GAGATCCGGACCGGCCGATAATCATCGGCCAGCTGCATAACGGCGTGAACCGGCCGCCGTACCCCTTGCC
GGCCCAGCGGAGCATGAGCGGCATCAAGTCGAGTTCCACCCCCGGTGGGGAAGGTTCTAACGAAGTGCGC
TTCGAGGACAGAAAGGGGGAGGAAGAGGTTTTTATCCACGCTGAGAGGCAGCAGGTAAACCGGGTGGAGG
AGGACTCTCGCGAGTGGGTGGGGCAGGATCGCCATGTTGAGGTCGGGCGGGACCGGTTTGAGACGGTATC
GCGTGATCAACGACTGACGGTCAGAGGTGCTGTCACTGTTACCGTCGGCGCGGATTTCCGGCAGCAGGTG
GCTGACAGGCACACCTTGCAGGCCGGGCAGGAGATACATCTGGCAGCGGGAGGGGAGTTGGTCCTCGATG
CGGGTGCTCGGATAACAATGCAGGTCGGGGGGAGCCGGATCATGATCGATCCGGGCGGCATCACCTTGGT
CGGCAACATAAGCAGGGGCGGGTTGTCCGCTTCTGCCCCGAAAGCCATTGAGGAACCTTCAGAAGTTTGA