SecReT6
Protein ID: 322420522
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3026
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3589813..3590841 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE8WHR9
KEGG IDgeb:GM18_3026
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-89, Aligned region: 6..308
Protein Sequence: 342 a.a.     [Download]
>gi|322420522|ref|YP_004199745.1| type VI secretion protein [Geobacter sp. M18]
MTRFRNAYHRHQFFQAVQRLERMHPADKGVGEALSPREEKIRFFARKGFSFPASEISKVEEKNDGSLDME
VAFMGVIGPRGALPDWYHELLLERLKAKDYAMGEFYDLFHHRLISLFYRAWKRNNLSAQKRHDNGDSFSV
YLLSLIGLGVAGVRETLGQSEQTLLFCSGQVSRRIPSACTIEKVVQQHFGIATEVEQFVPRVVHLEPPDR
MTLGQTNSRLGVDTVCGARIHDSQSSFRLCLGPMSYRDFSAFLSGQKLRSLVELTRFMAGLEYEFEVRLS
LKREEAPSCRLGETTAGSPRLGRSTWIHAPGTNLDADPFVTIHENEVKKAACDRADLEICGH
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3590841-3589813 Geobacter sp. M18 chromosome, complete genome
ATGACAAGGTTCCGGAATGCTTACCACCGTCACCAGTTCTTCCAGGCTGTCCAGCGCCTTGAACGCATGC
ACCCGGCAGATAAAGGGGTCGGAGAAGCGCTGTCGCCAAGGGAAGAGAAGATCCGGTTCTTTGCCAGGAA
AGGCTTCTCTTTTCCCGCCAGTGAGATCTCGAAGGTTGAAGAGAAGAATGACGGCAGCCTCGACATGGAA
GTTGCCTTCATGGGGGTGATAGGCCCGCGCGGCGCCTTGCCGGACTGGTACCACGAACTGCTACTGGAGC
GGCTGAAGGCTAAAGACTACGCCATGGGCGAGTTCTACGACCTGTTCCATCACCGGCTCATTTCGCTTTT
TTACCGGGCCTGGAAACGCAACAACTTGTCAGCCCAGAAGCGGCATGACAATGGTGACAGCTTCTCAGTC
TATCTCCTGAGCCTCATCGGACTAGGCGTGGCAGGTGTGCGAGAGACCCTCGGACAGTCGGAACAGACTC
TGCTTTTTTGCAGCGGGCAGGTGAGCCGCCGGATACCTTCAGCCTGCACCATCGAAAAGGTGGTTCAGCA
GCATTTCGGCATAGCAACCGAGGTCGAGCAGTTCGTTCCGCGCGTGGTTCATTTGGAGCCGCCCGACAGG
ATGACACTTGGGCAGACAAACAGCAGGCTCGGCGTGGATACAGTCTGCGGAGCCCGAATTCATGATAGCC
AGTCGAGCTTCCGTCTTTGCCTCGGGCCGATGTCCTATCGGGATTTCTCCGCATTCCTTTCGGGCCAGAA
GCTGAGATCCCTGGTGGAATTGACCAGGTTCATGGCCGGTCTGGAGTACGAGTTTGAGGTGCGGCTCAGT
CTCAAGAGAGAGGAAGCGCCATCCTGCAGGCTGGGTGAAACTACGGCCGGTTCTCCCCGGCTCGGCCGCT
CAACCTGGATACATGCACCAGGAACAAACCTTGATGCAGACCCGTTTGTGACAATCCACGAAAATGAGGT
CAAGAAGGCTGCCTGCGATCGGGCGGATCTGGAGATTTGCGGGCACTGA