SecReT6
Protein ID: 322420523
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3027
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3590838..3592634 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE8WHS0
KEGG IDgeb:GM18_3027
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-200, Aligned region: 5..598
Protein Sequence: 598 a.a.     [Download]
>gi|322420523|ref|YP_004199746.1| type VI secretion protein [Geobacter sp. M18]
MPEDFLNYFEKELCFLREMGSDFAGKYPKVAGRLLLEPDKCEDPHTERLIEAFAFLCARIQRKIDDGLPE
ITQSLLQVLYPHLSSPLPSVSVVRFNPLLKNVPGSGYHIDQGTPLFSRPVDGMPCQFRTVYPMVLWPMEV
VSAHVEEPRRLVKGAQQVVRIRLKLHGTSFSRFQGDSLRFFVNGQPQHAYPLYQLLLNNVCRIECTPAGA
PEGALPLENGCLSPVGFAAGEGLFPYPEQSFPGYRLLLEYFAFPQKFLFFELTGFSALGKGEFGDVIDLL
LYLNEATPDRLVVGAQTFCLHATPVVNAFQKTAEPIRHEHEKTEYRLLADLRREEGTEVLSVDDVTATVS
TSPLKVKKYRPVYSLEHYQHRDDVSEGNAYWHMQRRPSSLAHQCGTDVFLSFCGPGLDPAEPSEETVMVR
VTCSNRDLPSQLPFCDPSGDFQIEAAAPVETINCLIRPTRTLRPPLSGAQQWRLISHLSLNHLSLIEGGR
ASLKEMLALYDFGDSAATRQQISGIVSVTSRHVTRRIGAAFCRGVEVTVEFDEDKYIGSSLYLFASVLER
FLGQYVSVNSFVQLVARTARDNRVLKKWPARNGDRVLI
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3592634-3590838 Geobacter sp. M18 chromosome, complete genome
ATGCCAGAAGATTTCCTGAACTACTTCGAAAAGGAACTCTGTTTCCTGCGCGAGATGGGGAGCGACTTTG
CCGGGAAATATCCCAAGGTCGCCGGACGGCTTTTGCTGGAGCCGGATAAGTGCGAGGACCCGCACACCGA
GCGGCTGATCGAGGCCTTCGCCTTTCTCTGCGCGAGGATCCAGCGCAAGATCGACGACGGGCTGCCGGAA
ATCACCCAGTCGCTTTTGCAGGTTCTCTATCCTCACCTTAGCTCTCCTCTTCCGTCGGTGTCGGTGGTCA
GATTCAACCCGCTGCTGAAGAACGTTCCCGGCTCGGGTTATCATATCGACCAAGGCACGCCCCTTTTCTC
CAGGCCGGTCGACGGCATGCCCTGCCAGTTCAGGACCGTATACCCCATGGTGCTCTGGCCGATGGAAGTC
GTCAGCGCTCATGTCGAGGAACCAAGGAGGCTGGTAAAAGGGGCACAGCAGGTGGTCAGGATACGGCTCA
AGCTGCATGGCACAAGCTTTTCCCGTTTCCAGGGAGACTCCCTCCGGTTCTTTGTGAACGGGCAACCCCA
ACACGCCTACCCGTTGTACCAACTGCTGTTGAACAACGTGTGCAGGATCGAATGCACGCCGGCTGGCGCA
CCAGAAGGCGCCCTGCCACTGGAAAACGGCTGTTTGAGCCCCGTGGGGTTCGCGGCAGGCGAGGGGCTCT
TTCCCTATCCGGAGCAGTCGTTTCCCGGGTATCGACTGCTGTTGGAGTATTTCGCATTCCCGCAGAAGTT
TCTTTTTTTCGAGCTCACCGGATTCTCCGCACTTGGTAAAGGGGAGTTCGGCGATGTCATCGACCTGCTG
CTCTATCTGAATGAAGCGACACCGGATCGTCTGGTCGTTGGCGCCCAGACTTTCTGCCTGCACGCCACGC
CGGTCGTTAATGCCTTTCAAAAGACAGCGGAACCGATCAGGCACGAGCACGAAAAGACCGAGTATCGTCT
GCTTGCCGACCTGCGGCGGGAGGAGGGGACCGAGGTCCTGAGCGTCGATGACGTTACCGCCACGGTCTCC
ACCTCTCCCTTGAAGGTCAAGAAGTACCGCCCGGTATACTCGCTTGAGCATTACCAGCATCGAGATGACG
TCAGTGAGGGGAACGCGTATTGGCATATGCAGCGTCGGCCTTCCTCGCTTGCTCACCAATGCGGTACCGA
CGTGTTCCTTTCCTTTTGCGGCCCGGGCTTAGATCCGGCCGAACCTTCCGAGGAGACGGTGATGGTCCGC
GTTACCTGCTCCAACCGCGACCTTCCCTCACAACTTCCCTTCTGTGATCCTTCCGGCGATTTCCAGATCG
AGGCCGCGGCGCCGGTCGAAACAATAAACTGCCTGATCCGGCCGACCAGGACTCTGCGCCCCCCCTTGAG
CGGCGCCCAACAGTGGCGCCTGATCTCGCATCTGTCCCTCAACCACCTTTCCCTGATTGAGGGGGGGAGA
GCCTCCCTCAAGGAGATGCTTGCCTTGTATGACTTCGGCGACTCTGCCGCCACCAGGCAGCAGATCAGCG
GCATCGTATCCGTTACCTCGCGCCACGTCACCAGGAGGATAGGTGCCGCCTTCTGTCGGGGAGTCGAGGT
GACGGTGGAGTTCGACGAGGATAAGTACATCGGCAGCAGCCTCTATCTCTTCGCTTCCGTCCTGGAGCGG
TTTCTCGGGCAGTACGTATCGGTGAACTCCTTCGTCCAGTTAGTGGCTCGTACGGCCCGTGACAATCGGG
TGCTGAAAAAGTGGCCAGCGCGCAACGGGGACAGGGTGCTTATATGA