SecReT6
Protein ID: 322420524
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3028
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3592639..3593109 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE8WHS1
KEGG IDgeb:GM18_3028
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 36..136
Protein Sequence: 156 a.a.     [Download]
>gi|322420524|ref|YP_004199747.1| type VI secretion system lysozyme-like protein [Geobacter sp. M18]
MRLHPQLRGSLLDRLTDDAPEAAVEPVQSQSAGFNSMIRSVLRDLENLLNTRSLAGGAPLPAGETARSIL
AYGSRDFSSANPRSQEVRQQIRLEILTLLTRFEPRLKDARVRLDPIRREGRLNFRIEAVLQVEPVSVPTV
FDTCFDMNSGSYTIHT
 
Nucleotide Sequence: 471 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3593109-3592639 Geobacter sp. M18 chromosome, complete genome
ATGCGACTCCATCCGCAACTGAGAGGATCGCTGCTGGACAGGCTCACGGACGATGCGCCGGAAGCGGCCG
TCGAGCCTGTCCAGTCGCAAAGTGCCGGCTTCAACTCCATGATCCGGTCCGTATTGCGCGACCTGGAAAA
TCTCCTCAACACGAGATCGTTGGCAGGGGGCGCGCCGCTGCCCGCCGGAGAGACGGCACGGTCCATCCTG
GCCTATGGCAGTCGGGACTTCAGCTCGGCGAACCCGCGCTCGCAGGAGGTCAGGCAGCAGATACGGCTGG
AAATACTGACACTTCTGACCCGGTTCGAGCCCCGGCTGAAGGATGCCAGGGTAAGGCTTGACCCAATCCG
GAGAGAGGGCCGCCTCAACTTCCGGATCGAGGCCGTCCTGCAGGTCGAGCCGGTTAGCGTCCCCACCGTC
TTTGATACCTGCTTCGATATGAACAGCGGTTCTTACACCATCCATACGTGA