SecReT6
Protein ID: 322420525
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3029
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3593125..3593622 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDE8WHS2
KEGG IDgeb:GM18_3029
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-44, Aligned region: 6..140
Protein Sequence: 165 a.a.     [Download]
>gi|322420525|ref|YP_004199748.1| type VI secretion system effector [Geobacter sp. M18]
MAFDAFLKIEGIPGESNDDKHKEWIEVLSYNFSVTQSSSGTASSAGGASAERANFSDFSIVKVLDKSSPK
LFEACATGKHIPTVTLEICRAGGDKLKYMEYKLSNVIISLNRPGGSAHAGETLPVEEIAFNYGKIELAYT
QQNRSDGSGAGQVAAGWNLETNKKV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3593622-3593125 Geobacter sp. M18 chromosome, complete genome
ATGGCTTTTGATGCGTTTCTGAAGATAGAAGGGATACCGGGGGAAAGTAACGACGACAAGCACAAGGAGT
GGATCGAGGTACTCTCCTACAACTTCTCGGTTACCCAGAGCTCCTCCGGCACTGCCAGCAGCGCCGGAGG
AGCTTCCGCCGAGAGGGCGAACTTCTCGGACTTCAGCATCGTGAAGGTGCTGGACAAGTCGAGCCCCAAG
CTGTTCGAGGCCTGCGCCACCGGAAAGCACATCCCGACGGTGACCCTGGAGATCTGCCGGGCCGGCGGGG
ACAAGCTGAAGTACATGGAGTACAAGCTCTCCAACGTCATCATCAGCCTGAATCGTCCAGGCGGCAGCGC
ACACGCCGGCGAGACGCTCCCCGTCGAGGAGATCGCCTTCAACTACGGCAAGATCGAACTCGCCTATACC
CAGCAAAACCGCTCCGACGGCTCCGGCGCAGGACAGGTGGCGGCAGGGTGGAACCTGGAAACCAACAAGA
AGGTCTAG