SecReT6
Protein ID: 322420526
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3030
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3593658..3595142 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDE8WHS3
KEGG IDgeb:GM18_3030
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-192, Aligned region: 68..490
Protein Sequence: 494 a.a.     [Download]
>gi|322420526|ref|YP_004199749.1| EvpB family type VI secretion protein [Geobacter sp. M18]
MGEIERETAVRFAQQLPSTDVLELILSEGRLARYEDQKEYARELVAELAQQVLEGEIVVADDTMRMIHNR
IARIDQMIGDQVNQIIHHPEFQKLEASWRGLSYLVHQTETGSSLKIRVMNVSKKELSRDMEKAAEFDQSS
LFKKVYEEEFGSFGGASYGCLVGDYEFGNTPQDLSLLTRMSEVAAAAHAPLITSASATLFGLDSFTDLDA
PRDLSKSFQGEQYARWRSFRISEDAKYVALCLPRVLMRLPYTAESDPVESFQFEEEVDGSDHARYLWGNA
AYCLASRVTDAFARYGWTAAIRGVEGGGAVTGLPAHAFTTDAGELALKCPTEIAITDRREKELADLGFVP
LVHCKGTDTAAFFSVQSAHKTKIYDSDAANANARLSAQLQYILAVSRFAHYLKAMMRDKVGSFLTRKNVE
DYLNRWISRYVLLDDDAGQEMKARFPLREARVEVFDQPGRPGSYRAVAFLKPHYQLDELTVSLRLVANLP
SPQG
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3595142-3593658 Geobacter sp. M18 chromosome, complete genome
ATGGGAGAGATTGAAAGAGAAACCGCAGTCCGGTTCGCGCAGCAACTGCCTAGCACCGACGTGCTGGAGC
TCATCCTGAGCGAGGGGCGTCTGGCGCGTTACGAAGACCAGAAGGAGTACGCTAGGGAGTTGGTGGCGGA
ACTCGCGCAACAGGTGCTGGAAGGAGAAATCGTGGTTGCCGACGACACCATGCGGATGATCCACAACAGG
ATCGCCCGGATCGACCAGATGATCGGCGACCAGGTGAACCAGATCATTCATCACCCCGAGTTTCAAAAGC
TGGAGGCGTCCTGGCGCGGGCTCTCGTACCTCGTGCACCAGACCGAGACCGGCAGCAGCCTGAAGATCCG
CGTGATGAACGTGTCGAAAAAGGAGCTCTCCAGGGACATGGAGAAGGCAGCGGAATTCGACCAGTCGTCG
CTGTTCAAGAAGGTGTACGAGGAGGAGTTCGGCAGCTTCGGTGGCGCGTCTTATGGCTGCCTCGTGGGTG
ACTACGAGTTCGGCAACACCCCGCAGGACCTCTCCCTCCTGACCAGGATGTCCGAGGTCGCCGCCGCGGC
GCATGCCCCGCTGATCACCTCCGCGTCGGCGACCCTGTTCGGTCTGGACAGTTTCACGGATCTGGATGCG
CCAAGGGACCTGAGCAAGAGCTTTCAGGGGGAACAGTACGCCAGGTGGAGGTCGTTCCGGATATCCGAGG
ATGCGAAGTACGTGGCACTTTGCCTGCCGCGCGTGCTGATGAGGCTTCCTTACACAGCCGAGAGCGATCC
TGTCGAGTCGTTCCAGTTCGAGGAAGAGGTCGACGGAAGCGATCACGCCAGGTACCTGTGGGGCAACGCT
GCCTACTGCCTCGCCAGCCGCGTCACCGATGCCTTCGCCAGGTACGGCTGGACTGCGGCGATTCGCGGCG
TCGAGGGGGGAGGAGCGGTAACCGGTCTTCCTGCCCACGCCTTCACTACCGATGCAGGAGAGCTGGCGCT
CAAGTGCCCGACGGAGATCGCCATCACGGACCGGCGCGAGAAGGAGCTGGCAGATCTCGGCTTCGTGCCT
CTGGTGCACTGCAAGGGGACGGACACCGCCGCCTTCTTCAGCGTGCAGAGCGCGCACAAAACCAAGATCT
ACGACAGCGATGCCGCCAACGCCAATGCCAGACTTTCCGCTCAACTGCAGTACATCCTGGCCGTTTCGCG
TTTCGCCCACTACTTGAAGGCGATGATGCGCGACAAGGTCGGGAGCTTTCTGACCAGGAAAAATGTCGAG
GATTATCTGAACCGCTGGATCAGCAGGTACGTGCTGCTGGACGACGACGCGGGGCAGGAGATGAAAGCGC
GCTTCCCGCTCAGGGAAGCCCGCGTCGAGGTCTTTGACCAACCGGGGCGGCCGGGCTCCTATCGGGCGGT
TGCCTTCCTGAAGCCGCATTATCAGCTTGACGAGCTCACCGTTTCGTTGAGGCTCGTCGCCAACCTGCCG
TCGCCCCAGGGTTGA