SecReT6
Protein ID: 322420527
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3031
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3595157..3595678 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE8WHS4
KEGG IDgeb:GM18_3031
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-54, Aligned region: 11..162
Protein Sequence: 173 a.a.     [Download]
>gi|322420527|ref|YP_004199750.1| type VI secretion protein [Geobacter sp. M18]
MLTSESLQRKLERVRSPRVRITYDVEAGESVEVKEIPFVVGVLSDLCGTPDQPLAKLKERRFVEIDRDNF
NQVMEGMKPRLALKVDDKLKGDGVQLGVELRFESLDDFHPERVAQQVAPLRKLVEARRKLSDLLSKLDGN
DRLDDLLQELLGSKDSLKAISHNPVNPSGEESA
 
Nucleotide Sequence: 522 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3595678-3595157 Geobacter sp. M18 chromosome, complete genome
ATGCTTACTTCCGAAAGTCTGCAACGAAAGCTGGAGCGGGTGAGGTCACCGCGGGTCCGCATCACCTACG
ATGTCGAAGCCGGTGAGAGCGTCGAAGTGAAGGAGATTCCTTTCGTGGTGGGAGTCTTGTCCGATCTGTG
CGGTACGCCGGATCAGCCTCTTGCCAAGCTGAAGGAGAGAAGGTTCGTGGAGATCGACCGGGACAATTTC
AACCAGGTAATGGAAGGGATGAAGCCGAGGCTTGCCTTGAAGGTCGACGACAAGCTGAAAGGCGACGGGG
TGCAACTCGGCGTGGAACTGCGCTTCGAAAGCCTCGACGACTTCCATCCTGAGCGTGTGGCGCAGCAGGT
GGCGCCGCTTCGCAAGCTGGTCGAGGCAAGGCGGAAGCTGTCAGACCTGTTGAGCAAGCTGGACGGCAAT
GACCGGCTGGATGATCTGCTGCAGGAACTTTTGGGCAGCAAGGACTCCCTCAAGGCCATCAGCCACAACC
CAGTCAATCCGTCGGGCGAAGAGAGCGCCTGA