SecReT6
Protein ID: 322420528
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3032
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3595702..3597033 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE8WHS5
KEGG IDgeb:GM18_3032
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.60E-20, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 7.60E-20, Aligned region: 219..237
TPR_16 [PF13432], Evalue: 0.0044, Aligned region: 62..85
TPR_16 [PF13432], Evalue: 0.0044, Aligned region: 189..232
TPR_16 [PF13432], Evalue: 0.0044, Aligned region: 325..380
Protein Sequence: 443 a.a.     [Download]
>gi|322420528|ref|YP_004199751.1| type VI secretion-associated protein, ImpA family [Geobacter sp. M18]
MIRDICVDELLLPISEETPAGSDLRYTTIYEEIMEARRCEDAIAMGDWQHEVKKANWDKAISLAVSALGT
KSKDLQIAAWLTEAITVTEGFSGLDLGLQLVMGLAERFWETVYPLSEEGDLEYRATPFQFLNEKISLQVR
RIPLTDPEATPGYTWLKWQQSREVGSEADLKNRYGEIDEDKKIRRDELLAESALSAEDFDAAVARSKGAY
AGEIREQVARCRQSLNRLAEVLEAKFLNCAPSLAELASVVDGCSALLESLYGQKPTVEEDMAAAGAPGRS
EAGEIKGTGAAQPDGIAPPTERDLPAAASVAAGPGLPERTLWGDALAMLEAGRLQEALAMLLYTSNRSDS
VRDRNRGRLLMGKLCLQAGRPDLARPIIEELHRVIEELKLELWESPLWIAEVLEAYYQCLQAGGPRECDL
DLAQTLFRRICSLDITKAMPYRT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3597033-3595702 Geobacter sp. M18 chromosome, complete genome
ATGATCCGGGACATATGCGTCGACGAGCTGTTGCTTCCGATCTCGGAAGAAACCCCCGCTGGAAGCGACC
TCCGCTACACGACCATTTACGAGGAGATCATGGAAGCGCGTCGCTGCGAGGATGCCATCGCCATGGGAGA
CTGGCAGCACGAGGTCAAGAAGGCCAACTGGGACAAGGCCATCTCGCTTGCCGTCAGCGCCCTCGGCACC
AAAAGCAAGGACCTGCAGATAGCCGCATGGCTCACCGAGGCCATCACGGTGACCGAAGGGTTCAGCGGTC
TCGATCTCGGGCTGCAACTGGTCATGGGGCTTGCCGAGCGCTTCTGGGAGACGGTTTACCCGCTTAGCGA
GGAGGGGGACCTGGAATATCGGGCCACCCCCTTTCAATTCCTGAACGAGAAGATCTCCCTGCAGGTCAGG
CGGATCCCGCTTACCGATCCGGAAGCCACTCCCGGCTACACCTGGCTTAAGTGGCAGCAGTCCCGTGAAG
TCGGCTCCGAAGCCGACCTGAAGAACCGCTATGGCGAGATAGACGAGGACAAAAAGATCAGGCGTGATGA
ACTGCTAGCCGAGTCGGCCTTGAGCGCCGAAGACTTTGATGCCGCCGTGGCGCGATCCAAAGGGGCCTAT
GCCGGCGAAATCCGCGAGCAGGTTGCCAGGTGCCGGCAAAGTCTCAATCGATTGGCAGAGGTACTGGAGG
CAAAGTTCCTCAACTGCGCACCGAGCCTTGCCGAGCTTGCCTCGGTCGTCGATGGCTGCAGCGCGTTGCT
GGAAAGCCTCTATGGCCAAAAGCCGACGGTTGAAGAAGATATGGCAGCAGCAGGCGCACCGGGGCGATCG
GAAGCAGGAGAGATCAAGGGGACGGGGGCGGCGCAGCCCGATGGAATTGCGCCTCCTACCGAGCGCGATC
TTCCGGCGGCCGCCTCGGTTGCCGCCGGCCCGGGGCTGCCGGAGCGCACCCTTTGGGGAGATGCCCTTGC
CATGCTGGAGGCGGGGCGGCTGCAGGAGGCGCTGGCCATGTTGCTGTACACCAGCAACCGCTCTGATTCG
GTGCGCGATCGCAACAGGGGGAGGCTTTTGATGGGTAAGCTCTGTCTGCAGGCGGGGAGGCCGGATCTGG
CTCGACCCATAATCGAGGAACTGCACCGCGTTATAGAGGAGCTGAAGCTGGAGCTCTGGGAGTCCCCCCT
TTGGATCGCCGAGGTGCTGGAGGCCTACTATCAGTGCCTGCAGGCGGGGGGACCCCGGGAATGCGATCTC
GACTTGGCGCAGACGCTGTTCAGGCGCATCTGTTCACTAGACATCACGAAGGCGATGCCGTATCGCACCT
AG