SecReT6
Protein ID: 322420530
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3034
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3600495..3601160 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDE8WHS7
KEGG IDgeb:GM18_3034
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.10E-41, Aligned region: 1..213
Protein Sequence: 221 a.a.     [Download]
>gi|322420530|ref|YP_004199753.1| DotU family type IV / VI secretion system protein [Geobacter sp. M18]
MRLIDCFMPLIAYVVEFRNALPQCEADYLQVKGEIRQLLAQSEAMSQGTGCNQEEFDRSRFIVCAWVDET
LLASQWPDRQFWQHEQLQRLYYKTTDAGVEAFERLDALGQQQQAREVYCICLALGFRGRYIGEQGEFLLE
QLRTANLKLLFEAPEAVPALNGLRLFPASLADQPATAVRVKEPSFLSTPWGAAWLAAPVVLFAVMYLVYR
YVLNGLVLPNL
 
Nucleotide Sequence: 666 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3601160-3600495 Geobacter sp. M18 chromosome, complete genome
ATGAGACTGATCGACTGCTTCATGCCGCTGATAGCCTATGTCGTCGAGTTCCGTAACGCCCTGCCGCAGT
GCGAAGCCGACTACCTGCAGGTGAAGGGGGAAATTCGGCAGCTGCTGGCGCAATCCGAAGCGATGTCACA
AGGGACGGGGTGCAACCAGGAAGAGTTCGACCGGTCACGGTTCATCGTCTGCGCCTGGGTCGACGAGACG
CTCCTCGCCTCGCAGTGGCCTGACCGGCAGTTCTGGCAGCACGAGCAGTTGCAGCGCCTTTACTATAAGA
CCACGGACGCCGGGGTCGAGGCGTTCGAACGGCTGGACGCCCTGGGGCAGCAGCAACAGGCGCGAGAGGT
GTATTGTATCTGCCTCGCCCTTGGCTTCAGGGGGCGCTATATCGGTGAGCAGGGGGAGTTTCTCCTGGAG
CAGTTGAGGACGGCGAACCTGAAGCTGCTTTTTGAGGCTCCAGAGGCCGTTCCTGCGCTGAACGGCCTGA
GGCTGTTTCCGGCATCCCTGGCAGATCAGCCGGCAACCGCCGTCAGGGTAAAGGAACCATCCTTTCTCTC
GACACCGTGGGGGGCTGCCTGGTTAGCCGCGCCGGTCGTCCTGTTCGCCGTCATGTACCTCGTGTACCGC
TATGTGCTAAACGGTCTGGTCCTTCCGAACCTCTAG